Gene Information

Name : Sthe_0182 (Sthe_0182)
Accession : YP_003318443.1
Strain :
Genome accession: NC_013523
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator, winged helix family
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 204320 - 205015 bp
Length : 696 bp
Strand : -
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver; KEGG: bcl:ABC0529 two-component response regulator

DNA sequence :
ATGGAGCGACCGACAACCGTGCTGATCGTGGACGACGAGGAGGACATCGTCGCCCTGATGCGCGACTTCCTGGAGGCCGA
GGGCTATGCGGTCCTGGCGGCCTACGACGGCCCGACCGCGCTTCGCACGCTGGAGCACGAGCCGGTTGACTGTGTCCTGC
TCGACGTGATGATGCCGGGCCCGTCCGGCTATGACGTGCTGCGGCGCATCCGCGAGAACCGGGATGTGCCGGTCCTCTTC
CTCACCGCCCGACAGGAGGACCATGACAAGATCCGCGGTCTGGGACTCGGCGCCGACGATTTCATCGTCAAGTCCGCTAC
ACCCGGCGAAGTCGTCGCCCGCATCAAGGCAGTCCTCCGCCGCTACCGGCGCGGCGAGCCAGCACCCCGCGCCGTCCTCG
ACTTCGGCCGGCTCGTGATCGACGTGCAGGCGCACGAGGTCCGCGTCGATGGCAAGCCGGTGCAACTGACAGCGCGCGAG
TTCGAGTTGCTCCAGCTCTTCGCCGAGCACCCACGCCAGGTCTTCACCCGCGAGCAGCTCTTCCAGCGGCTCTGGGGCGA
GTTCGGCGACCGGCATACCGTCACCGTGCACATCGGGCGACTGCGGGAGAAGATCGAGGAAGACCCGGCCAACCCGCGCT
ACATCGTGACGGTCTGGGGCGTTGGCTATCGCTTCGACGGGGAGGCCCGCCCATGA

Protein sequence :
MERPTTVLIVDDEEDIVALMRDFLEAEGYAVLAAYDGPTALRTLEHEPVDCVLLDVMMPGPSGYDVLRRIRENRDVPVLF
LTARQEDHDKIRGLGLGADDFIVKSATPGEVVARIKAVLRRYRRGEPAPRAVLDFGRLVIDVQAHEVRVDGKPVQLTARE
FELLQLFAEHPRQVFTREQLFQRLWGEFGDRHTVTVHIGRLREKIEEDPANPRYIVTVWGVGYRFDGEARP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 3e-36 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Sthe_0182 YP_003318443.1 two component transcriptional regulator, winged helix family AM180355.1.gene1830. Protein 2e-40 44
Sthe_0182 YP_003318443.1 two component transcriptional regulator, winged helix family AF162694.1.orf4.gene Protein 7e-43 44
Sthe_0182 YP_003318443.1 two component transcriptional regulator, winged helix family AE016830.1.gene1681. Protein 7e-39 43
Sthe_0182 YP_003318443.1 two component transcriptional regulator, winged helix family AF155139.2.orf0.gene Protein 6e-48 43
Sthe_0182 YP_003318443.1 two component transcriptional regulator, winged helix family DQ212986.1.gene4.p01 Protein 7e-40 43
Sthe_0182 YP_003318443.1 two component transcriptional regulator, winged helix family EU250284.1.orf4.gene Protein 1e-40 43
Sthe_0182 YP_003318443.1 two component transcriptional regulator, winged helix family FJ349556.1.orf0.gene Protein 1e-46 42
Sthe_0182 YP_003318443.1 two component transcriptional regulator, winged helix family AF130997.1.orf0.gene Protein 1e-37 42
Sthe_0182 YP_003318443.1 two component transcriptional regulator, winged helix family NC_002952.2859905.p0 Protein 5e-38 42
Sthe_0182 YP_003318443.1 two component transcriptional regulator, winged helix family NC_009641.5332272.p0 Protein 9e-38 42
Sthe_0182 YP_003318443.1 two component transcriptional regulator, winged helix family NC_013450.8614421.p0 Protein 9e-38 42
Sthe_0182 YP_003318443.1 two component transcriptional regulator, winged helix family NC_007793.3914279.p0 Protein 9e-38 42
Sthe_0182 YP_003318443.1 two component transcriptional regulator, winged helix family NC_002745.1124361.p0 Protein 9e-38 42
Sthe_0182 YP_003318443.1 two component transcriptional regulator, winged helix family NC_009782.5559369.p0 Protein 9e-38 42
Sthe_0182 YP_003318443.1 two component transcriptional regulator, winged helix family NC_002951.3237708.p0 Protein 9e-38 42
Sthe_0182 YP_003318443.1 two component transcriptional regulator, winged helix family NC_012469.1.7685629. Protein 2e-36 42
Sthe_0182 YP_003318443.1 two component transcriptional regulator, winged helix family NC_003923.1003749.p0 Protein 8e-38 42
Sthe_0182 YP_003318443.1 two component transcriptional regulator, winged helix family NC_002758.1121668.p0 Protein 9e-38 42
Sthe_0182 YP_003318443.1 two component transcriptional regulator, winged helix family NC_007622.3794472.p0 Protein 5e-38 42
Sthe_0182 YP_003318443.1 two component transcriptional regulator, winged helix family AE000516.2.gene3505. Protein 5e-32 42
Sthe_0182 YP_003318443.1 two component transcriptional regulator, winged helix family NC_012469.1.7686381. Protein 9e-36 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Sthe_0182 YP_003318443.1 two component transcriptional regulator, winged helix family VFG1386 Protein 6e-36 43
Sthe_0182 YP_003318443.1 two component transcriptional regulator, winged helix family VFG1702 Protein 1e-36 41
Sthe_0182 YP_003318443.1 two component transcriptional regulator, winged helix family VFG1389 Protein 2e-29 41