Gene Information

Name : Taci_0090 (Taci_0090)
Accession : YP_003316612.1
Strain : Thermanaerovibrio acidaminovorans DSM 6589
Genome accession: NC_013522
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 98894 - 99580 bp
Length : 687 bp
Strand : -
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver; KEGG: nha:Nham_0640 two component transcriptional regulator

DNA sequence :
ATGAGATGGAGGATACTAGTGGTGGAAGACGAGGAGGGCATAAGGGAGATCCTCTCCGAGGCGTTTCGCCGCCAGGGGTA
CACGGTCATGTGTGCCGCGGACGGAGACCAAGCGGTGGACCTGGCGCTTACCGCCGTGCCGGACTTGATAATTCTGGATC
TGATGCTGCCCAAGATGGACGGATGGGAAGTCTGCCGTAGGATCCGGGAGGAGCAGGAGCTTAGGCACGTGCCGGTGATA
ATGCTTACCGCCCGGCGGGACGAGCGGGATGCGGTGGCGGGGCTGGAGGCGGGGGCGGACGACTACGTCCGGAAGCCCTT
CTCCATCCCGGAGCTGATGGCCCGGGTGAGGGCCCACCTGAGGCGCTCCGACTCCCCCCAGGGGGGTGAGGTCCAGATAT
CCATGGGGAACCTGACGTTGGAGCCCCAGGGGGACGTGCTGGTGGACGGGCGACCCCTGGACCTCTCCCCCACGGAGCAC
CGGCTCCTGGAGGTGCTCATGTCCGGCCGGGGGAGGCTGGTGAGCAAGGAGGAGATCCTGGGCAAGATCTGGGGGCACGT
GGGGAGCGACAGCAGGACCGTGGACGTAAACGTGTTCCGCCTGAGGCGAAAGCTTGAGGAGGCAGGTGCCCGGGTTACCA
TAAAGACCGTCCGGGGCAGGGGCTACCGGGTCATGGAGGTGTCCTAG

Protein sequence :
MRWRILVVEDEEGIREILSEAFRRQGYTVMCAADGDQAVDLALTAVPDLIILDLMLPKMDGWEVCRRIREEQELRHVPVI
MLTARRDERDAVAGLEAGADDYVRKPFSIPELMARVRAHLRRSDSPQGGEVQISMGNLTLEPQGDVLVDGRPLDLSPTEH
RLLEVLMSGRGRLVSKEEILGKIWGHVGSDSRTVDVNVFRLRRKLEEAGARVTIKTVRGRGYRVMEVS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
mprA YP_005684640.1 response regulator mprA Not tested PiCp 3 Protein 1e-30 41
mprA YP_005680459.1 response regulator mprA Not tested PiCp 3 Protein 1e-30 41
mprA YP_005682550.1 response regulator mprA Not tested PiCp 3 Protein 1e-30 41
tcsR1 YP_003782583.1 two-component system transcriptional regulatory protein Not tested PiCp 3 Protein 1e-30 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Taci_0090 YP_003316612.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 8e-38 44
Taci_0090 YP_003316612.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 8e-38 44
Taci_0090 YP_003316612.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 6e-38 44
Taci_0090 YP_003316612.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 6e-38 44
Taci_0090 YP_003316612.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 6e-38 44
Taci_0090 YP_003316612.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 4e-38 44
Taci_0090 YP_003316612.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 6e-38 44
Taci_0090 YP_003316612.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 6e-38 44
Taci_0090 YP_003316612.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 6e-38 44
Taci_0090 YP_003316612.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 6e-38 44
Taci_0090 YP_003316612.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 6e-32 44
Taci_0090 YP_003316612.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 9e-36 41
Taci_0090 YP_003316612.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 9e-36 41
Taci_0090 YP_003316612.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 9e-36 41
Taci_0090 YP_003316612.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 9e-36 41
Taci_0090 YP_003316612.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 9e-36 41
Taci_0090 YP_003316612.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 9e-36 41
Taci_0090 YP_003316612.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 9e-36 41
Taci_0090 YP_003316612.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 9e-36 41
Taci_0090 YP_003316612.1 winged helix family two component transcriptional regulator BAC0197 Protein 2e-25 41
Taci_0090 YP_003316612.1 winged helix family two component transcriptional regulator BAC0083 Protein 8e-31 41
Taci_0090 YP_003316612.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 4e-38 41
Taci_0090 YP_003316612.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 8e-29 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Taci_0090 YP_003316612.1 winged helix family two component transcriptional regulator VFG1390 Protein 8e-36 41
Taci_0090 YP_003316612.1 winged helix family two component transcriptional regulator VFG1386 Protein 5e-31 41