Gene Information

Name : Sked_33960 (Sked_33960)
Accession : YP_003316124.1
Strain : Sanguibacter keddieii DSM 10542
Genome accession: NC_013521
Putative virulence/resistance : Resistance
Product : stress response protein, TerZ- and CABP1
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG2310
EC number : -
Position : 3799622 - 3800197 bp
Length : 576 bp
Strand : -
Note : PFAM: Bacterial stress protein

DNA sequence :
GTGGGAGTCAGTCTTACCAAGGGCGGGAACGTCTCGCTCACCAAAGAGGCACCTGGTCTGACCGCAGTCACCGTCGGCCT
CGGCTGGGACGCACGGTCCACGACCGGGACCGACTTCGACCTCGACGCGAGCGCCATCATGGCCGGCGTCAGCGGCAAGG
TCCTCTCCGACGGACACTTCGTCTTCTTCAACAACCTCACGAGCGTCGACGGCTCCGTCCAGCACCTCGGTGACAACCTC
ACCGGTGAGGGCGACGGCGACGACGAGGAGATCAACGTCAACCTCGCGGCCGTGCCGCCGGAGGTCGACAAGATCGTGTT
CCCCGTCTCGATCTACGACGCCGCAGCCCGCTCGCAGAGCTTCGGCCAGGTCCGCAACGCGTTCATCCGCGTCATCAACC
AGGCCGGCGGCGCCGAGATCGCGCGCTACGACCTCAGCGAGGACGCCTCGACCGAGACCGCCATGGTGTTCGGCGAGCTC
TACCGCAACGGCGCCGAGTGGAAGTTCCGCGCGGTCGGCCAGGGATACGCCGAGGGCCTCGTGGGCATCGCCCGCGACTT
CGGCGTGGGCGTCTGA

Protein sequence :
MGVSLTKGGNVSLTKEAPGLTAVTVGLGWDARSTTGTDFDLDASAIMAGVSGKVLSDGHFVFFNNLTSVDGSVQHLGDNL
TGEGDGDDEEINVNLAAVPPEVDKIVFPVSIYDAAARSQSFGQVRNAFIRVINQAGGAEIARYDLSEDASTETAMVFGEL
YRNGAEWKFRAVGQGYAEGLVGIARDFGVGV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 6e-59 67
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 6e-59 67
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 8e-59 66
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-58 66
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-58 66
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 2e-58 66
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 5e-58 65
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 1e-58 64
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 2e-31 42
terZ NP_286706.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 8e-28 42
terZ_2 NP_287114.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 8e-28 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Sked_33960 YP_003316124.1 stress response protein, TerZ- and CABP1 BAC0389 Protein 9e-58 65
Sked_33960 YP_003316124.1 stress response protein, TerZ- and CABP1 BAC0390 Protein 1e-59 64
Sked_33960 YP_003316124.1 stress response protein, TerZ- and CABP1 BAC0392 Protein 3e-28 43