Gene Information

Name : Tcur_0824 (Tcur_0824)
Accession : YP_003298452.1
Strain : Thermomonospora curvata DSM 43183
Genome accession: NC_013510
Putative virulence/resistance : Resistance
Product : stress protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG2310
EC number : -
Position : 924296 - 924865 bp
Length : 570 bp
Strand : +
Note : PFAM: stress protein; KEGG: noc:Noc_1008 stress protein

DNA sequence :
GTGACCGTCTCGATGGTGAAGGGCCAGCGGATCTCACTGGAGAAGCCCGGGGGCACACTGAGCATGGTCCGGATGGGCCT
GGGCTGGGACGCGGTCAAAAAGCGGGGCTTCTTCGGCTCCCGCGAACGGGAGATCGACCTGGACGCCTCCTGCCTGCTGT
TCGCCGACGGCCAGCTGGCGGACGTGGTCTACTTCGGCAAGCTCACCAGCAGCGACGGGTCGGTGCGGCACACCGGTGAC
AACCTCACCGGCGTCGGCGACGGCGACGACGAGTCGGTGATCGTGGACCTGACCAGGGTGCCGGTGCACGTGACCTCGCT
GGTGTTCACCGTCAGCTCCTTCAACGGGCAGACCTTCAACGAGGTGGAGAACGCCTTCTGCCGGCTGGTGGACGAGACCA
CCGGCGCCGAGCTGGCCCGCTACACCCTCACCGGCGGCGGCGCCCACACCGGCATGGTGATGGCCAAGCTGTACCGGCAC
GGGGGCGGCTGGAAGATGAACGCCATCGGCGAGCCCGCCCAGGGCCGCACCTTCCAGGACATGCTCCCGGCCATCGCCGC
CCACGCTTAA

Protein sequence :
MTVSMVKGQRISLEKPGGTLSMVRMGLGWDAVKKRGFFGSREREIDLDASCLLFADGQLADVVYFGKLTSSDGSVRHTGD
NLTGVGDGDDESVIVDLTRVPVHVTSLVFTVSSFNGQTFNEVENAFCRLVDETTGAELARYTLTGGGAHTGMVMAKLYRH
GGGWKMNAIGEPAQGRTFQDMLPAIAAHA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 7e-45 53
terZ NP_286706.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-38 52
terZ_2 NP_287114.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-38 52
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 2e-30 44
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 7e-29 44
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 7e-29 44
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 2e-28 43
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 7e-28 41
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-27 41
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-27 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Tcur_0824 YP_003298452.1 stress protein BAC0392 Protein 4e-39 52
Tcur_0824 YP_003298452.1 stress protein BAC0389 Protein 1e-28 44