Gene Information

Name : Tcur_4122 (Tcur_4122)
Accession : YP_003301688.1
Strain : Thermomonospora curvata DSM 43183
Genome accession: NC_013510
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 4704855 - 4705526 bp
Length : 672 bp
Strand : -
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver; KEGG: scl:sce2434 two-component response regulator

DNA sequence :
ATGACGTCTGTACTGCTCGCTGAGGACGACACCTCCATCTCCGAGCCTCTCGCCCGCGCACTGCGGCGCGAGGGGTACAC
CGTTGAAGTCAGCCCCGACGGCCCCCAGGCGCTCGAAAGGGCGCTGGGCGGCGGGGTCGACCTCATCGTGCTCGACCTCG
GGCTCCCCGAGCTCGACGGGCTGGAAGTGGCACGTCGGGTGCGCTCGGAAGGACACGGCGTGCCCATCCTGATCCTGACC
GCCCGGGCCGACGAAGTGGACACCGTCGTCGGGCTTGACGCGGGCGCCGACGACTACGTCACCAAACCGTTCCGGCTGGC
CGAACTGCTGGCCCGGGTGCGCGCCCTGCTGCGGCGGGGCAGCACCGAGACCCCGATCGTGCAAGGGGTGCGGATCGACG
CCGAGTCGCGCCGCGCCTGGATGGGCGATCAGGAGCTCCAGCTCACCACCAAGGAGTTCGACCTGCTGCGGGTGCTGGTC
CGGGACGCCGGCAAGGTCGTCACCAGAGAACAGATCATGCGGGAGGTGTGGGACACCAACTGGTGGGGTTCCACCAAGAC
CCTGGACATGCACATCTCGTGGCTGCGCCGCAAGCTGGGCGACGACGCCGCCAACCCGCGCTACATCACCACCGTGCGAG
GCGTCGGGTTCCGCTTCGAGCGCGGTGACTGA

Protein sequence :
MTSVLLAEDDTSISEPLARALRREGYTVEVSPDGPQALERALGGGVDLIVLDLGLPELDGLEVARRVRSEGHGVPILILT
ARADEVDTVVGLDAGADDYVTKPFRLAELLARVRALLRRGSTETPIVQGVRIDAESRRAWMGDQELQLTTKEFDLLRVLV
RDAGKVVTREQIMREVWDTNWWGSTKTLDMHISWLRRKLGDDAANPRYITTVRGVGFRFERGD

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 3e-15 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Tcur_4122 YP_003301688.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 6e-23 43
Tcur_4122 YP_003301688.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 6e-23 43
Tcur_4122 YP_003301688.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 6e-23 43
Tcur_4122 YP_003301688.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 6e-23 43
Tcur_4122 YP_003301688.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 6e-23 43
Tcur_4122 YP_003301688.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 6e-23 43
Tcur_4122 YP_003301688.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 6e-23 43
Tcur_4122 YP_003301688.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 6e-23 43
Tcur_4122 YP_003301688.1 winged helix family two component transcriptional regulator BAC0083 Protein 4e-21 43
Tcur_4122 YP_003301688.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 1e-25 42
Tcur_4122 YP_003301688.1 winged helix family two component transcriptional regulator AE015929.1.gene1106. Protein 4e-19 41
Tcur_4122 YP_003301688.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 7e-29 41
Tcur_4122 YP_003301688.1 winged helix family two component transcriptional regulator BAC0111 Protein 2e-19 41
Tcur_4122 YP_003301688.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 7e-29 41
Tcur_4122 YP_003301688.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 7e-29 41
Tcur_4122 YP_003301688.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 6e-29 41
Tcur_4122 YP_003301688.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 7e-29 41
Tcur_4122 YP_003301688.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 7e-29 41
Tcur_4122 YP_003301688.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 7e-29 41
Tcur_4122 YP_003301688.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 7e-29 41
Tcur_4122 YP_003301688.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 7e-29 41
Tcur_4122 YP_003301688.1 winged helix family two component transcriptional regulator BAC0638 Protein 2e-13 41
Tcur_4122 YP_003301688.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 7e-29 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Tcur_4122 YP_003301688.1 winged helix family two component transcriptional regulator VFG1390 Protein 5e-26 43
Tcur_4122 YP_003301688.1 winged helix family two component transcriptional regulator VFG0596 Protein 1e-15 42
Tcur_4122 YP_003301688.1 winged helix family two component transcriptional regulator VFG1389 Protein 3e-24 42
Tcur_4122 YP_003301688.1 winged helix family two component transcriptional regulator VFG0473 Protein 1e-15 42