Gene Information

Name : Tcur_3799 (Tcur_3799)
Accession : YP_003301368.1
Strain : Thermomonospora curvata DSM 43183
Genome accession: NC_013510
Putative virulence/resistance : Resistance
Product : stress protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG2310
EC number : -
Position : 4346640 - 4347215 bp
Length : 576 bp
Strand : +
Note : PFAM: stress protein; KEGG: noc:Noc_1002 stress protein

DNA sequence :
ATGAGTGTCAGCCTTTCCAAGGGCGGCAACGTCTCGCTCAGCAAGCAGGCGCCGGGCCTGACCGCGATCACGGTCGGGCT
GGGCTGGGACGTGCGGACCACCACCGGCGCCGACTTCGACCTGGACGCCAGCGCGCTGCTGGTGGACGCCTCCGGCAAGG
TCCTGTCCGACCAGCACTTCGTCTTCTTCAACAACCTGCGCAGCCCGGAGGGATCGGTCGAGCACACCGGCGACAACCTC
ACCGGCGAGGGCGAGGGCGACGACGAGCAGATCAAGGTCGATCTGACCGCGGTCCCGCCCGAGGCCGCCCGGATCGTCTT
CCCGGTCTCCATCTACGACGCCGACAGCCGCGGCCAGACCTTCGGGCAGGTCCGCAACGCCTTCATCCGCGTGGTCAACC
AGGCCGACGGCACCGAGATCGCCCGCTACGACCTCACCGAGGACGCCTCCACCGAGACCGCCATGATCTTCGGCGAGCTG
TACCGGCACGGCAGCGAGTGGAAGTTCCGCGCGGTCGGCCAGGGGTACGCCTCGGGGCTGGCGGGCATCGCCAGGGACTA
CGGCGTCAACGTCTGA

Protein sequence :
MSVSLSKGGNVSLSKQAPGLTAITVGLGWDVRTTTGADFDLDASALLVDASGKVLSDQHFVFFNNLRSPEGSVEHTGDNL
TGEGEGDDEQIKVDLTAVPPEAARIVFPVSIYDADSRGQTFGQVRNAFIRVVNQADGTEIARYDLTEDASTETAMIFGEL
YRHGSEWKFRAVGQGYASGLAGIARDYGVNV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 3e-62 68
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 7e-61 67
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 2e-60 67
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 7e-61 67
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 5e-61 65
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 7e-61 65
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 7e-61 65
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 6e-57 61
terZ NP_286706.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-29 42
terZ_2 NP_287114.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-29 42
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 2e-32 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Tcur_3799 YP_003301368.1 stress protein BAC0389 Protein 2e-60 66
Tcur_3799 YP_003301368.1 stress protein BAC0390 Protein 2e-62 65
Tcur_3799 YP_003301368.1 stress protein BAC0392 Protein 6e-29 41