Gene Information

Name : Tcur_3193 (Tcur_3193)
Accession : YP_003300772.1
Strain : Thermomonospora curvata DSM 43183
Genome accession: NC_013510
Putative virulence/resistance : Resistance
Product : stress protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG2310
EC number : -
Position : 3695284 - 3695859 bp
Length : 576 bp
Strand : -
Note : PFAM: stress protein; KEGG: noc:Noc_1002 stress protein

DNA sequence :
TTGGGCGTCAGTCTGAGCAAGGGCGGCAATGTCTCGCTCACCAAGCAGGCACCCGGCCTGACCGCGGTCACCGTCGGCCT
GGGCTGGGATGTGCGCACCACCACCGGTACCGACTTCGATCTGGACGCCTCGGCCATCGTCGTCGACGCCTCCGGCAAGG
TGCTGTCGGATCAGCACTTCGTCTTCTTCAACAATCTGCGCAGCCCGGAGGGCGCCGTGGTGCACAGCGGCGACAACCTC
ACCGGGGCGGGAGAGGGCGACGATGAGCAGATCAAGGTCGACCTGACCGCCCTGCCCCCGCAGGCGCAGCGGGTGGCGTT
CGCCGTCTCCATCTACGAGGCCGACTCGCGCGGCCAGAACTTCGGCCAGGTCCGCAACGCCTTCATCCGCGTGGTCAACC
AGGCCGACGGCAACGAGCTGGCCCGCTATGACCTGTCCGAGGACGCCTCCACCGAGACCGCCATGGTTTTCGGTGAGCTT
TACCGCCACGGCGCGGAGTGGAAATTCCGCGCCATCGGCCAGGGCTATGCCTCGGGACTGGCCGGCATCGCTATGGACTT
CGGGGTCAACGTCTGA

Protein sequence :
MGVSLSKGGNVSLTKQAPGLTAVTVGLGWDVRTTTGTDFDLDASAIVVDASGKVLSDQHFVFFNNLRSPEGAVVHSGDNL
TGAGEGDDEQIKVDLTALPPQAQRVAFAVSIYEADSRGQNFGQVRNAFIRVVNQADGNELARYDLSEDASTETAMVFGEL
YRHGAEWKFRAIGQGYASGLAGIAMDFGVNV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 9e-59 64
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-58 64
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-58 64
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 4e-60 62
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 1e-55 61
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 2e-57 60
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 7e-58 60
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 7e-58 60
terZ NP_286706.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 5e-31 44
terZ_2 NP_287114.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 5e-31 44
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 8e-33 44

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Tcur_3193 YP_003300772.1 stress protein BAC0390 Protein 9e-60 65
Tcur_3193 YP_003300772.1 stress protein BAC0389 Protein 2e-57 60
Tcur_3193 YP_003300772.1 stress protein BAC0392 Protein 2e-30 43