Gene Information

Name : Tcur_3192 (Tcur_3192)
Accession : YP_003300771.1
Strain : Thermomonospora curvata DSM 43183
Genome accession: NC_013510
Putative virulence/resistance : Resistance
Product : stress protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG2310
EC number : -
Position : 3694610 - 3695188 bp
Length : 579 bp
Strand : -
Note : PFAM: stress protein; KEGG: noc:Noc_1002 stress protein

DNA sequence :
ATGGGAGTTTCCCTCGCCAAAGGCGGCAACGTCTCGCTGACCAAGGCCGCGCCCAACCTGACTGCAGTGTCGGTCGGCCT
GGGCTGGGATGTGCGGACCACGACCGGCGCGGACTTCGACCTGGACGCCTCGGCGCTGATGCTGGGCGCCAACGGCAAGG
TCCTCTCCGACCGGCACTTCGTGTTCTACAACAACCTGCGCAGCCCCGACGGCTCGGTGGAGCACACCGGTGACAACCTC
ACCGGTGAGGGCGAGGGCGACGACGAGGTCATCAACGTCGATCTGACCGCCGTCCCGCCCGAGTGCGAGCGCATCGTCTT
CCCGGTGTCGATCTATGACGCCGACAACCGCGGCCAGACCTTCGGTCAGGTCCGCAACGCCTTCATCCGCATCGTCAACC
GGTCCGACAACTCCGAGCTGGCCCGTTTCGACCTCACCGAGGACGCCTCCACCGAGACCGCAATGATCTTCGGTGAGCTT
TACCGCTATCAGTCCGAGTGGAAGTTCCGGGCGGTCGGCCAAGGGTATGCTTCGGGCTTGGCCGGTATCGCCATGGACTT
CGGCGTCAACGTAGGCTGA

Protein sequence :
MGVSLAKGGNVSLTKAAPNLTAVSVGLGWDVRTTTGADFDLDASALMLGANGKVLSDRHFVFYNNLRSPDGSVEHTGDNL
TGEGEGDDEVINVDLTAVPPECERIVFPVSIYDADNRGQTFGQVRNAFIRIVNRSDNSELARFDLTEDASTETAMIFGEL
YRYQSEWKFRAVGQGYASGLAGIAMDFGVNVG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 2e-58 65
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 7e-59 65
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 7e-59 65
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 2e-58 65
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 5e-57 62
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 8e-57 62
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 8e-57 62
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 8e-55 61
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 4e-31 44

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Tcur_3192 YP_003300771.1 stress protein BAC0390 Protein 6e-59 64
Tcur_3192 YP_003300771.1 stress protein BAC0389 Protein 4e-58 64