Gene Information

Name : Tcur_1461 (Tcur_1461)
Accession : YP_003299078.1
Strain : Thermomonospora curvata DSM 43183
Genome accession: NC_013510
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1664522 - 1665199 bp
Length : 678 bp
Strand : -
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver; KEGG: glo:Glov_0588 two component transcriptional regulator, winged helix family

DNA sequence :
GTGCCGAGACACCGCATCCTGGTCGTGGAGGACGAACCGGCCATCGCCGAGGCGGTGGCCGAGCGGCTGCGGGCCGAGGG
CTTTACGGCCGTGATCGCCCGGGACGGCCTGGATGCCGTCGAGCGCTTCCGCCGCAGCGCACCGGACCTGGTGGTGCTGG
ACCTGATGCTGCCCGGCCTGGACGGGCTGGAGGTCTGCCGGCGGCTGCAGGCCGAACGGCCGGTGCCGGTGCTGATGCTC
ACCGCCCGCGGCGAGGAGACCGACCAGCTGATCGGGCTGGGCGTGGGCGCCGACGACTATCTGACCAAGCCGTTCAGCAT
GCGGGTGCTGGTGGCGCGGGTGCGGGCGCTGCTGCGCCGCATCGAACGGGCGCGCTCTGGGACGCACCCGGTGGTGCGGC
TGGGCGGCCTGGAGGTGGACCGGGCGGCGCGCCGGGTCCGCCTGCGGGGCGCCCAGGTGCACCTGACGCCGACGGAGTTC
GAGCTGCTGGCCTTCCTGGCCGGCGCCCCCGGCACCGTGTTCTCCCGGGCCGAGCTGCTGGAACGGGTCTGGGGCTGGAC
GGCGGGCGCCGGGACGCGCACGGTCGACAGCCACGTGCGGGCGCTGCGCCGCAAGCTCGGCGACGAGATCATCCGCACCG
CGCACGGCGTGGGGTACGCGCTGGAGCCCCCGCGGTGA

Protein sequence :
MPRHRILVVEDEPAIAEAVAERLRAEGFTAVIARDGLDAVERFRRSAPDLVVLDLMLPGLDGLEVCRRLQAERPVPVLML
TARGEETDQLIGLGVGADDYLTKPFSMRVLVARVRALLRRIERARSGTHPVVRLGGLEVDRAARRVRLRGAQVHLTPTEF
ELLAFLAGAPGTVFSRAELLERVWGWTAGAGTRTVDSHVRALRRKLGDEIIRTAHGVGYALEPPR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 8e-27 41
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 1e-26 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Tcur_1461 YP_003299078.1 winged helix family two component transcriptional regulator U82965.2.orf14.gene. Protein 5e-20 44
Tcur_1461 YP_003299078.1 winged helix family two component transcriptional regulator BAC0638 Protein 2e-22 43
Tcur_1461 YP_003299078.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 2e-38 43
Tcur_1461 YP_003299078.1 winged helix family two component transcriptional regulator BAC0039 Protein 2e-31 42
Tcur_1461 YP_003299078.1 winged helix family two component transcriptional regulator CP000034.1.gene2186. Protein 2e-31 42
Tcur_1461 YP_003299078.1 winged helix family two component transcriptional regulator NC_002695.1.916589.p Protein 2e-31 42
Tcur_1461 YP_003299078.1 winged helix family two component transcriptional regulator BAC0083 Protein 1e-26 41
Tcur_1461 YP_003299078.1 winged helix family two component transcriptional regulator Y16952.3.orf35.gene. Protein 2e-21 41
Tcur_1461 YP_003299078.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 8e-33 41
Tcur_1461 YP_003299078.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 5e-34 41
Tcur_1461 YP_003299078.1 winged helix family two component transcriptional regulator BAC0197 Protein 5e-24 41
Tcur_1461 YP_003299078.1 winged helix family two component transcriptional regulator BAC0596 Protein 2e-30 41
Tcur_1461 YP_003299078.1 winged helix family two component transcriptional regulator CP001138.1.gene2239. Protein 2e-30 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Tcur_1461 YP_003299078.1 winged helix family two component transcriptional regulator VFG1389 Protein 1e-26 46
Tcur_1461 YP_003299078.1 winged helix family two component transcriptional regulator VFG1390 Protein 2e-31 41
Tcur_1461 YP_003299078.1 winged helix family two component transcriptional regulator VFG1563 Protein 5e-27 41
Tcur_1461 YP_003299078.1 winged helix family two component transcriptional regulator VFG1702 Protein 6e-27 41
Tcur_1461 YP_003299078.1 winged helix family two component transcriptional regulator VFG1386 Protein 4e-32 41