Gene Information

Name : folP (ETAE_p041)
Accession : YP_003297635.1
Strain :
Genome accession: NC_013509
Putative virulence/resistance : Resistance
Product : dihydropteroate synthase-like enzyme
Function : -
COG functional category : H : Coenzyme transport and metabolism
COG ID : COG0294
EC number : -
Position : 32101 - 32916 bp
Length : 816 bp
Strand : -
Note : -

DNA sequence :
ATGAATAAATCGCTCATCATTTTCGGCATCGTCAACATAACCTCGGACAGTTTCTCCGATGGAGGCCGGTATCTGGCGCC
AGACGCAGCCATTGCGCAGGCGCGTAAGCTGATGGCCGAGGGGGCAGATGTGATCGACCTCGGTCCGGCATCCAGCAATC
CCGACGCCGCGCCTGTTTCGTCCGACACAGAAATCGCGCGTATCGCGCCGGTGCTGGACGCGCTCAAGGCAGATGGCATT
CCCGTCTCGCTCGACAGTTATCAACCCGCGACGCAAGCCTATGCCTTGTCGCGTGGTGTGGCCTATCTCAATGATATTCG
CGGTTTTCCAGACGCTGCGTTCTATCCGCAATTGGCGAAATCATCTGCCAAACTCGTCGTTATGCATTCGGTGCAAGACG
GGCAGGCAGATCGGCGCGAGGCACCCGCTGGCGACATCATGGATCACATTGCGGCGTTCTTTGACGCGCGCATCGCGGCG
CTGACGGGTGCCGGTATCAAACGCAACCGCCTTGTCCTTGATCCCGGCATGGGGTTTTTTCTGGGGGCTGCTCCCGAAAC
CTCGCTCTCGGTGCTGGCGCGGTTCGATGAATTGCGGCTGCGCTTCGATTTGCCGGTGCTTCTGTCTGTTTCGCGCAAAT
CCTTTCTGCGCGCGCTCACAGGCCGTGGTCCGGGGGATGTCGGGGCCGCGACACTCGCTGCAGAGCTTGCCGCCGCCGCA
GGTGGAGCTGACTTCATCCGCACACACGAGCCGCGCCCCTTGCGCGACGGGCTGGCGGTATTGGCGGCGCTGAAAGAAAC
CGCAAGAATTCGTTAA

Protein sequence :
MNKSLIIFGIVNITSDSFSDGGRYLAPDAAIAQARKLMAEGADVIDLGPASSNPDAAPVSSDTEIARIAPVLDALKADGI
PVSLDSYQPATQAYALSRGVAYLNDIRGFPDAAFYPQLAKSSAKLVVMHSVQDGQADRREAPAGDIMDHIAAFFDARIAA
LTGAGIKRNRLVLDPGMGFFLGAAPETSLSVLARFDELRLRFDLPVLLSVSRKSFLRALTGRGPGDVGAATLAAELAAAA
GGADFIRTHEPRPLRDGLAVLAALKETARIR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
sul2 AEA34678.1 dihydropteroate synthase Not tested Not named Protein 1e-112 100
sul2 YP_005176181.1 dihydropteroate synthase Not tested ICEPmu1 Protein 3e-95 100
sulI2 AFV47959.1 sulphonamide-insensitive dihydropteroate synthase SulI2 Not tested AbaR25 Protein 1e-112 100
sul2 AEZ06044.1 Sul2, sulphonamide-insensitive dihydropteroate synthase Not tested Tn6167 Protein 2e-112 100
ABK1_0255 YP_005512827.1 Dihydropteroate synthase type-2 Not tested AbaR4d Protein 4e-112 100
BJAB07104_00246 YP_008207711.1 Dihydropteroate synthase-related enzyme Not tested AbaR25 Protein 4e-112 100
BJAB0868_00253 YP_008211579.1 Dihydropteroate synthase-related enzyme Not tested AbaR26 Protein 1e-111 99
sul1 AET25390.1 Sul1 Not tested PAGI-2(C) Protein 2e-54 53
sul1 ACN81027.1 Sul1, sulfonamide-resistant dihydropteroate synthase Not tested AbaR5 Protein 3e-54 53
sul1 AGK07075.1 Sul1 dihydropteroate synthase Not tested SGI1 Protein 2e-54 53
sul1 AFG30113.1 Sul1 Not tested PAGI-2 Protein 2e-54 53
sul1 ADZ05806.1 dihydropteroate synthase Not tested AbaR20 Protein 3e-54 53
sul1 ACN81038.2 Sul1, sulfonamide-resistant dihydropteroate synthase Not tested AbaR5 Protein 3e-54 53
sul1 AGK07110.1 Sul1 dihydropteroate synthase Not tested SGI1 Protein 2e-54 53
sul1 AAG03004.2 sulfonamide resistance protein Not tested SGI1 Protein 2e-54 53
sul1 AFV53112.1 dihydropteroate synthase Not tested AbGRI2-1 Protein 2e-54 53
sul1 AGF34990.1 Sul1 dihydropteroate synthase Not tested SGI1 Protein 2e-54 53
sul1 ABB48429.1 sulfonamide insensitive dihydropteroate synthase Not tested SGI1 Protein 2e-54 53
sul1 AGK36648.1 Sul1 Not tested AbaR26 Protein 2e-54 53
sul1 AGF35029.1 Sul1 dihydropteroate synthase Not tested SGI1 Protein 2e-54 53
sul1 ACY75524.1 Sul1 Not tested Tn6060 Protein 2e-54 53
ACICU_00228 YP_001844887.1 dihydropteroate synthase Not tested AbaR20 Protein 3e-54 53
sul1 AGF35064.1 Sul1 dihydropteroate synthase Not tested SGI1 Protein 2e-54 53
sul1 ACY75531.1 Sul1 Not tested Tn6060 Protein 2e-54 53
sul1 YP_005797135.1 sulfonamide-resistant dihydropteroate synthase Not tested AbaR4e Protein 3e-54 53
sul1 AGK06934.1 Sul1 dihydropteroate synthase Not tested SGI1 Protein 2e-54 53
sul1 ADI24148.1 dihydropteroate synthase Not tested AbaR1 Protein 2e-54 53
sul1 YP_005797151.1 sulfonamide-resistant dihydropteroate synthase Not tested AbaR4e Protein 3e-54 53
sul1 ADZ05750.1 dihydropteroate synthase Not tested AbaR10 Protein 2e-54 53
sul1 AGK06980.1 Sul1 dihydropteroate synthase Not tested SGI1 Protein 2e-54 53
sul1 ADZ05756.1 dihydropteroate synthase Not tested AbaR10 Protein 2e-54 53
sulI YP_006098378.1 dihydropteroate synthase type-1 Not tested Tn2411 Protein 3e-54 53
sul1 AGK07017.1 Sul1 dihydropteroate synthase Not tested SGI1 Protein 2e-54 53
sul1 ACF06164.1 dihydropteroate synthase Not tested Tn5036-like Protein 5e-54 53
sul1 ACF06160.1 dihydropteroate synthase Not tested Tn5036-like Protein 2e-54 53
sulI CAJ77053.1 sul1delta fusion protein Not tested AbaR1 Protein 2e-54 53
sulI CAJ77050.1 sul1delta fusion protein Not tested AbaR1 Protein 2e-54 53
sulI CAJ77089.1 sul1delta fusion protein Not tested AbaR1 Protein 2e-54 53
sul1 ACS32048.1 Sul1; sulfonamide-insensitive dihydropteroate synthase Not tested SGI2 Protein 2e-54 52
sul1 YP_005160002.1 dihydropteroate synthase Not tested Not named Protein 2e-54 52

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
folP YP_003297635.1 dihydropteroate synthase-like enzyme DQ464881.1.gene2.p01 Protein 3e-111 99
folP YP_003297635.1 dihydropteroate synthase-like enzyme AJ459418.gene.p01 Protein 8e-58 53
folP YP_003297635.1 dihydropteroate synthase-like enzyme DQ143913.1.gene6.p01 Protein 3e-54 53
folP YP_003297635.1 dihydropteroate synthase-like enzyme EF118171.1.gene7.p01 Protein 2e-54 53
folP YP_003297635.1 dihydropteroate synthase-like enzyme AB061794.1.gene5.p01 Protein 2e-54 53
folP YP_003297635.1 dihydropteroate synthase-like enzyme AF313471.1.gene7.p01 Protein 2e-54 53
folP YP_003297635.1 dihydropteroate synthase-like enzyme AY339625.2.gene19.p0 Protein 2e-54 53
folP YP_003297635.1 dihydropteroate synthase-like enzyme AY740681.1.gene7.p01 Protein 2e-54 53
folP YP_003297635.1 dihydropteroate synthase-like enzyme HQ451074.1.gene20.p0 Protein 2e-54 53
folP YP_003297635.1 dihydropteroate synthase-like enzyme AF174129.3.gene6.p01 Protein 2e-54 53
folP YP_003297635.1 dihydropteroate synthase-like enzyme U37105.2.gene6.p01 Protein 2e-54 53
folP YP_003297635.1 dihydropteroate synthase-like enzyme AY162283.2.gene6.p01 Protein 2e-54 53
folP YP_003297635.1 dihydropteroate synthase-like enzyme AF191564.1.gene5.p01 Protein 1e-54 53
folP YP_003297635.1 dihydropteroate synthase-like enzyme NC_011586.7045179.p0 Protein 1e-54 53
folP YP_003297635.1 dihydropteroate synthase-like enzyme NC_011586.7045208.p0 Protein 1e-53 52