Gene Information

Name : ylcA (ETAE_1663)
Accession : YP_003295715.1
Strain : Edwardsiella tarda EIB202
Genome accession: NC_013508
Putative virulence/resistance : Virulence
Product : DNA-binding response regulator in two-component regulatory system with CusS
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1771189 - 1771872 bp
Length : 684 bp
Strand : -
Note : -

DNA sequence :
GTGAAGATACTGATCGTCGAGGATGAGGTGAAAACCGGGAAATACCTGTGTAAGGGGCTGACAGAGGCGGGATTTGTCGT
CGATCTCGCCGACAACGGTTTAACGGGATACCACCTGGCGATGACCGCCGGCTATGATCTGATCATCCTTGATATCCTGC
TGCCCGACGTCAACGGCTGGGAGATCGTCCGCATGCTGCGCAGCGCCAACCAGGGACTGCCGATCCTGCTGCTGAGCGCC
CTCGGCACCATCGAGCAGCGGGTAAAGGGGCTGGAGCTCGGCGCCGACGACTACCTGGTCAAGCCCTTCGCCTTCGCCGA
GCTCTTGGCGCGGGTGAGAACCCTACTGAGACGCGGCAGCCCCCCTATCCCCGAGAGCCAGTTTCACGTCGCCGATCTCA
CCGTGGAGCTCCTTTCCAGAAAGGTGACCCGCGGCGGTAAGCGCATCACGCTAACGGGGAAAGAGTTCACCCTGGTGACG
TTTTTTATCCGTCACCAGGGCGAGGTGCTGCCCCGCTCCCTGATCGCCTCGCAGGTCTGGGACATGAACTTCGACAGCGA
CACCAACGCCATCGACGTGGCCGTGAAGCGGCTGCGGGCGAAGATCGACCTCGACTTCGAACCTAAGCTGATCCAGACGG
TGCGCGGCGTGGGCTACCTGCTCGAGGCGCCGGATGTCGACTAA

Protein sequence :
MKILIVEDEVKTGKYLCKGLTEAGFVVDLADNGLTGYHLAMTAGYDLIILDILLPDVNGWEIVRMLRSANQGLPILLLSA
LGTIEQRVKGLELGADDYLVKPFAFAELLARVRTLLRRGSPPIPESQFHVADLTVELLSRKVTRGGKRITLTGKEFTLVT
FFIRHQGEVLPRSLIASQVWDMNFDSDTNAIDVAVKRLRAKIDLDFEPKLIQTVRGVGYLLEAPDVD

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 7e-48 54
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 4e-47 53

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ylcA YP_003295715.1 DNA-binding response regulator in two-component regulatory system with CusS BAC0111 Protein 9e-86 87
ylcA YP_003295715.1 DNA-binding response regulator in two-component regulatory system with CusS BAC0347 Protein 3e-77 79
ylcA YP_003295715.1 DNA-binding response regulator in two-component regulatory system with CusS BAC0083 Protein 2e-62 62
ylcA YP_003295715.1 DNA-binding response regulator in two-component regulatory system with CusS BAC0638 Protein 5e-57 60
ylcA YP_003295715.1 DNA-binding response regulator in two-component regulatory system with CusS BAC0197 Protein 4e-56 59
ylcA YP_003295715.1 DNA-binding response regulator in two-component regulatory system with CusS BAC0308 Protein 5e-56 58
ylcA YP_003295715.1 DNA-binding response regulator in two-component regulatory system with CusS BAC0125 Protein 2e-56 54

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ylcA YP_003295715.1 DNA-binding response regulator in two-component regulatory system with CusS VFG0596 Protein 3e-48 54
ylcA YP_003295715.1 DNA-binding response regulator in two-component regulatory system with CusS VFG1390 Protein 2e-38 43
ylcA YP_003295715.1 DNA-binding response regulator in two-component regulatory system with CusS VFG1389 Protein 2e-28 41