Gene Information

Name : FI9785_1290 (FI9785_1290)
Accession : YP_003293417.1
Strain : Lactobacillus johnsonii FI9785
Genome accession: NC_013504
Putative virulence/resistance : Virulence
Product : two-component system response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1213678 - 1214388 bp
Length : 711 bp
Strand : -
Note : -

DNA sequence :
ATGCTAAAAATTTTAATGGTTGAGGATGACAATTCTGTTGCAGAAATGATGAAGATGTTCTTTAGTAAAGAACAATGGGA
TGTTGATATAGCTAAAGATGGAGTAGAAGCTGTTGAAATGTTTAAAAAAGCTCCAGATTCTTATGATATAGTTACGCTGG
ATCTTAACTTACCTAAAAAAGATGGTATGGAAGTAGCTAAAGAAATTAGAGCTATTTCCTTATCAATTCCAATAATTATG
CTTACGGCTCGTGACTCAGAAAGTGATCAAATTTTGGGTTTAGGAATTGGTGCTGATGAGTATGTTACTAAGCCCTTTAG
TCCTTTGGCCTTAATAGCACGGATCAAGGCGCTATATCGCAGAAGCCATCTGGAAAAGGATATGCATGCTTCTAATGGCA
TAAAATATGACGTAGTAACTAAGCATTTAAAAATTTCGAAGGACCGTCGAGAAGTACGATTTGATGATAAAGTTGTTGAA
GGTTTGACCCCTAAGGAATTTGATTTGCTTTATACTATGGCTCAAAAGCCAAAGCAGGTTTTTTCAAGAGACAAACTTTT
AGAGCTAGTGTGGGGATATGAGTTTTTCGGTGAGGAAAGAACTGTCGATGCTCATATTAAAAAATTACGTCAAAAGTTAG
AGAAAGCTGGTCCGCAAGTAGTTCAAACCGTTTGGGGTGTGGGCTACAAGTTTGATGATTCTGAGGTATAG

Protein sequence :
MLKILMVEDDNSVAEMMKMFFSKEQWDVDIAKDGVEAVEMFKKAPDSYDIVTLDLNLPKKDGMEVAKEIRAISLSIPIIM
LTARDSESDQILGLGIGADEYVTKPFSPLALIARIKALYRRSHLEKDMHASNGIKYDVVTKHLKISKDRREVRFDDKVVE
GLTPKEFDLLYTMAQKPKQVFSRDKLLELVWGYEFFGEERTVDAHIKKLRQKLEKAGPQVVQTVWGVGYKFDDSEV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 7e-39 43
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 1e-38 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
FI9785_1290 YP_003293417.1 two-component system response regulator NC_012469.1.7685629. Protein 1e-39 44
FI9785_1290 YP_003293417.1 two-component system response regulator AE000516.2.gene3505. Protein 4e-33 42
FI9785_1290 YP_003293417.1 two-component system response regulator CP001918.1.gene5135. Protein 5e-25 42
FI9785_1290 YP_003293417.1 two-component system response regulator NC_002952.2859905.p0 Protein 2e-40 41
FI9785_1290 YP_003293417.1 two-component system response regulator NC_013450.8614421.p0 Protein 1e-40 41
FI9785_1290 YP_003293417.1 two-component system response regulator NC_007793.3914279.p0 Protein 1e-40 41
FI9785_1290 YP_003293417.1 two-component system response regulator NC_007622.3794472.p0 Protein 2e-40 41
FI9785_1290 YP_003293417.1 two-component system response regulator NC_002745.1124361.p0 Protein 1e-40 41
FI9785_1290 YP_003293417.1 two-component system response regulator NC_009782.5559369.p0 Protein 1e-40 41
FI9785_1290 YP_003293417.1 two-component system response regulator NC_002951.3237708.p0 Protein 1e-40 41
FI9785_1290 YP_003293417.1 two-component system response regulator NC_003923.1003749.p0 Protein 1e-40 41
FI9785_1290 YP_003293417.1 two-component system response regulator NC_002758.1121668.p0 Protein 1e-40 41
FI9785_1290 YP_003293417.1 two-component system response regulator NC_009641.5332272.p0 Protein 1e-40 41
FI9785_1290 YP_003293417.1 two-component system response regulator HE999704.1.gene2815. Protein 2e-39 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
FI9785_1290 YP_003293417.1 two-component system response regulator VFG1563 Protein 4e-39 43
FI9785_1290 YP_003293417.1 two-component system response regulator VFG1702 Protein 4e-39 43