Gene Information

Name : Rmar_0513 (Rmar_0513)
Accession : YP_003289803.1
Strain : Rhodothermus marinus DSM 4252
Genome accession: NC_013501
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 577618 - 578304 bp
Length : 687 bp
Strand : -
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver; KEGG: vsp:VS_II1475 putative DNA-binding response regulator

DNA sequence :
ATGCCTCGTCCGATTTTACTGGTGGAAGACGAGATCGCCATGGCGGCCCTGTTGCGTCAGGGGTTGGAGGAAGAGGGCTA
CGCGGTCGAATGGGTGCTCACCGGCGAAGAAGCCCTGGCGCGCCTGGAGCATCTGGAGCCGGCCCTGCTGGTGCTGGACG
TACGACTGCCGGGCATGGATGGCGTGGAAGTGTGCCGCCAGGTACGCCAGCGCTGGCCGGATCTACCTGTTCTGATGCTG
ACGGCCCTCGACGATGTCGAAAATCGCGTGCGCGGGCTACGAGCCGGTGCCGACGACTATCTGCCCAAACCGTTCGCCTT
TGAAGAACTGCTGGCCCGGATCGAAGCCCTGCTGCGCCGAAGCAAGCGCCAGCCCACCCGCCACCTGCTGCGCAATGGTC
CGCTCACGCTCGACCTGAACGCCCGCACCGCCACCTGTGGCGAGCGCACGCTTTCCCTTACGCCGCGCGAATTCGATCTG
CTGGCCTACCTGATGCAACACCCCCGTCGGGCGATTTCGCGGCTGCAGATCTACCGCGAAGTGTGGGGCCACGACTTCGA
CCACGGCACCAGCCTGCTCGAAGTGTATATCAGCTACTTGCGCCGCAAATTGCAGGAAGCAGGCTGCCCGGGCTACATTG
CAACGGTCCGGGGCGTCGGTTACCGCTATGAACCGGCCGAAGGGTGA

Protein sequence :
MPRPILLVEDEIAMAALLRQGLEEEGYAVEWVLTGEEALARLEHLEPALLVLDVRLPGMDGVEVCRQVRQRWPDLPVLML
TALDDVENRVRGLRAGADDYLPKPFAFEELLARIEALLRRSKRQPTRHLLRNGPLTLDLNARTATCGERTLSLTPREFDL
LAYLMQHPRRAISRLQIYREVWGHDFDHGTSLLEVYISYLRRKLQEAGCPGYIATVRGVGYRYEPAEG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 6e-21 41
armR AAN62112.1 putative response-regulator ArmR Not tested PAGI-2(C) Protein 3e-13 41
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 3e-20 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Rmar_0513 YP_003289803.1 winged helix family two component transcriptional regulator BAC0125 Protein 2e-27 43
Rmar_0513 YP_003289803.1 winged helix family two component transcriptional regulator BAC0083 Protein 5e-27 43
Rmar_0513 YP_003289803.1 winged helix family two component transcriptional regulator BAC0197 Protein 7e-25 43
Rmar_0513 YP_003289803.1 winged helix family two component transcriptional regulator BAC0288 Protein 2e-26 42
Rmar_0513 YP_003289803.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 7e-27 41
Rmar_0513 YP_003289803.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 7e-27 41
Rmar_0513 YP_003289803.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 7e-27 41
Rmar_0513 YP_003289803.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 7e-27 41
Rmar_0513 YP_003289803.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 7e-27 41
Rmar_0513 YP_003289803.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 7e-27 41
Rmar_0513 YP_003289803.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 7e-27 41
Rmar_0513 YP_003289803.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 7e-27 41
Rmar_0513 YP_003289803.1 winged helix family two component transcriptional regulator NC_002516.2.879194.p Protein 7e-23 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Rmar_0513 YP_003289803.1 winged helix family two component transcriptional regulator VFG1390 Protein 3e-37 53
Rmar_0513 YP_003289803.1 winged helix family two component transcriptional regulator VFG1389 Protein 3e-28 43
Rmar_0513 YP_003289803.1 winged helix family two component transcriptional regulator VFG0473 Protein 4e-18 42
Rmar_0513 YP_003289803.1 winged helix family two component transcriptional regulator VFG0596 Protein 2e-21 41