Gene Information

Name : Rmar_2453 (Rmar_2453)
Accession : YP_003291718.1
Strain : Rhodothermus marinus DSM 4252
Genome accession: NC_013501
Putative virulence/resistance : Resistance
Product : MerR family transcriptional regulator
Function : -
COG functional category : K : Transcription
COG ID : COG0789
EC number : -
Position : 2852853 - 2853320 bp
Length : 468 bp
Strand : +
Note : PFAM: Transcription regulator MerR DNA binding; regulatory protein MerR; SMART: regulatory protein MerR; KEGG: sal:Sala_2470 MerR family transcriptional regulator

DNA sequence :
ATGGAAGCCTGCAAACCGTTGGCTGAACTCATGCTGACACGCAGCGAACTGGCGCAAAAGGCCGGCGTGCACGCCGAAAC
GATCCGCTACTACGAGCAGCGGGGCCTGTTGCCTCCGCCCCGCCGGACGGCCGCCGGCTACCGCGCCTACTCCGAAACGG
ACGTGGCCCGCCTGCGCTTCATCAAACGGGCGCAGGAGCTGGGTTTCTCGCTCCGTGAAATCGAAGAACTGCTGACGCTC
GAGGCGACCCCGGGCGCCAGCAGCGGGCTGGTCCGCCAGCGGGCGCTGGCCAAGATCGCCGAAATCGAGGCGCGCATCCG
GGACCTGACCCGCATCCGCGATACGCTGCGCCGGCTGGTGGCCGCCTGCGACGGCAAAGCGCCCGTCGAACACTGTCCGA
TCCTTCACGCCCTGCACGACGACCATGGAACGCACGCCGACACCGGAACCCCTGACGGAAACGCCTGA

Protein sequence :
MEACKPLAELMLTRSELAQKAGVHAETIRYYEQRGLLPPPRRTAAGYRAYSETDVARLRFIKRAQELGFSLREIEELLTL
EATPGASSGLVRQRALAKIAEIEARIRDLTRIRDTLRRLVAACDGKAPVEHCPILHALHDDHGTHADTGTPDGNA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
merR AAN62181.1 organomercurial resistance regulatory protein MerR Not tested PAGI-2(C) Protein 2e-16 42
merR ACN81009.1 MerR activator/repressor of mer operon Not tested AbaR5 Protein 2e-18 42
merR CAJ77064.1 Mercury resistance operon regulatory protein Not tested AbaR1 Protein 1e-18 42
unnamed ABR13397.1 mercuric resistance operon regulatory protein Not tested PAGI-5 Protein 5e-17 41
SE0081 NP_763636.1 hypothetical protein Not tested SCCpbp4 Protein 2e-16 41
unnamed BAB47646.1 orf2 Not tested Type-III SCCmec Protein 1e-16 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Rmar_2453 YP_003291718.1 MerR family transcriptional regulator BAC0682 Protein 1e-19 45
Rmar_2453 YP_003291718.1 MerR family transcriptional regulator BAC0569 Protein 3e-18 44
Rmar_2453 YP_003291718.1 MerR family transcriptional regulator BAC0689 Protein 4e-18 43
Rmar_2453 YP_003291718.1 MerR family transcriptional regulator BAC0182 Protein 9e-21 42
Rmar_2453 YP_003291718.1 MerR family transcriptional regulator BAC0462 Protein 2e-16 41
Rmar_2453 YP_003291718.1 MerR family transcriptional regulator BAC0301 Protein 4e-16 41