Gene Information

Name : CtCNB1_4385 (CtCNB1_4385)
Accession : YP_003280427.1
Strain : Comamonas testosteroni CNB-1
Genome accession: NC_013446
Putative virulence/resistance : Virulence
Product : two component heavy metal response
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 4925995 - 4926702 bp
Length : 708 bp
Strand : +
Note : COG0745, OmpR, Response regulators consisting of a CheY-likereceiver domain and a winged-helix DNA-binding domain

DNA sequence :
TTGCTCGACAATCTGCGCATGAAGCTTCTAGTCATCGAGGACGAAACCAAACTCGCCGAATACTTGCAAAAAGGCCTGGG
CGAGGAAGGCTTTGTGGTCGATGCCGCGCACAACGGCATTGACGGCCTGCATCTGGCCACCGAGCAGCCCTACGACCTCA
TCATTCTGGACGGCATGCTGCCCGGCATAGACGGCCTGGCCGTGCTGGCGGCTCTGCGCCAGTCTCGCCAGACACCAGTG
CTCATGCTCACGGCCCGCGCCCAGGTGGAAGACCGCGTCAAAGGACTGCAGGCCGGCGCCGATGACTACCTGGTCAAGCC
TTTTGCGTTTTCAGAACTGGTGGCCCGCATTCATGCACTGCTGCGCCGTGGCCTGCAGGCCCAGGCCACGCCCGAAGCCA
CTGTGCTGCGCATGGCCGATCTGGAGCTGGATCTGCTGCGTCACCGCGCCACGCGTGCTGGCCAGCGACTGGACCTGACG
GCCAAGGAGTTCAATCTGCTGAGTCTGCTGCTGCGGCGCCAGGGCGAAGTGCTGTCACGCACCGAGCTGGCCTCCCAGGT
CTGGGACATGAACTTCGACAGCGAAACCAATGTCGTCGAGGTCGCCGTGCGCCGCCTGCGCCTCAAGCTCGACGCGCCGT
TCGAGCTGCCCCTGCTGCACACGGTGCGCGGCATGGGCTATGTGCTGGAGCTTCGCCTTGATGCCTGA

Protein sequence :
MLDNLRMKLLVIEDETKLAEYLQKGLGEEGFVVDAAHNGIDGLHLATEQPYDLIILDGMLPGIDGLAVLAALRQSRQTPV
LMLTARAQVEDRVKGLQAGADDYLVKPFAFSELVARIHALLRRGLQAQATPEATVLRMADLELDLLRHRATRAGQRLDLT
AKEFNLLSLLLRRQGEVLSRTELASQVWDMNFDSETNVVEVAVRRLRLKLDAPFELPLLHTVRGMGYVLELRLDA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-57 57
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 7e-57 56

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
CtCNB1_4385 YP_003280427.1 two component heavy metal response BAC0083 Protein 9e-63 63
CtCNB1_4385 YP_003280427.1 two component heavy metal response BAC0197 Protein 1e-67 62
CtCNB1_4385 YP_003280427.1 two component heavy metal response BAC0638 Protein 3e-57 62
CtCNB1_4385 YP_003280427.1 two component heavy metal response BAC0125 Protein 9e-66 61
CtCNB1_4385 YP_003280427.1 two component heavy metal response BAC0111 Protein 3e-60 57
CtCNB1_4385 YP_003280427.1 two component heavy metal response BAC0308 Protein 3e-57 56
CtCNB1_4385 YP_003280427.1 two component heavy metal response BAC0347 Protein 4e-54 52
CtCNB1_4385 YP_003280427.1 two component heavy metal response NC_002516.2.879194.p Protein 1e-32 43
CtCNB1_4385 YP_003280427.1 two component heavy metal response HE999704.1.gene1528. Protein 1e-33 43
CtCNB1_4385 YP_003280427.1 two component heavy metal response NC_002952.2859858.p0 Protein 5e-39 42
CtCNB1_4385 YP_003280427.1 two component heavy metal response NC_007622.3794948.p0 Protein 5e-39 42
CtCNB1_4385 YP_003280427.1 two component heavy metal response NC_003923.1003417.p0 Protein 5e-39 42
CtCNB1_4385 YP_003280427.1 two component heavy metal response NC_013450.8614146.p0 Protein 5e-39 42
CtCNB1_4385 YP_003280427.1 two component heavy metal response NC_002951.3238224.p0 Protein 5e-39 42
CtCNB1_4385 YP_003280427.1 two component heavy metal response AE015929.1.gene1106. Protein 5e-35 42
CtCNB1_4385 YP_003280427.1 two component heavy metal response NC_007793.3914065.p0 Protein 5e-39 42
CtCNB1_4385 YP_003280427.1 two component heavy metal response NC_002758.1121390.p0 Protein 5e-39 42
CtCNB1_4385 YP_003280427.1 two component heavy metal response NC_010079.5776364.p0 Protein 5e-39 42
CtCNB1_4385 YP_003280427.1 two component heavy metal response CP000675.2.gene1535. Protein 1e-35 41
CtCNB1_4385 YP_003280427.1 two component heavy metal response CP000647.1.gene4257. Protein 7e-27 41
CtCNB1_4385 YP_003280427.1 two component heavy metal response CP000034.1.gene3834. Protein 4e-27 41
CtCNB1_4385 YP_003280427.1 two component heavy metal response CP001138.1.gene4273. Protein 4e-27 41
CtCNB1_4385 YP_003280427.1 two component heavy metal response BAC0533 Protein 7e-27 41
CtCNB1_4385 YP_003280427.1 two component heavy metal response NC_002695.1.915041.p Protein 4e-27 41
CtCNB1_4385 YP_003280427.1 two component heavy metal response AE000516.2.gene3505. Protein 2e-31 41
CtCNB1_4385 YP_003280427.1 two component heavy metal response CP001918.1.gene5135. Protein 2e-24 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
CtCNB1_4385 YP_003280427.1 two component heavy metal response VFG0596 Protein 5e-58 57
CtCNB1_4385 YP_003280427.1 two component heavy metal response VFG1389 Protein 7e-39 47
CtCNB1_4385 YP_003280427.1 two component heavy metal response VFG1390 Protein 1e-40 43
CtCNB1_4385 YP_003280427.1 two component heavy metal response VFG1386 Protein 9e-37 43
CtCNB1_4385 YP_003280427.1 two component heavy metal response VFG0473 Protein 6e-32 42