Gene Information

Name : CtCNB1_2722 (CtCNB1_2722)
Accession : YP_003278764.1
Strain : Comamonas testosteroni CNB-1
Genome accession: NC_013446
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 3112859 - 3113575 bp
Length : 717 bp
Strand : -
Note : COG0745, OmpR, Response regulators consisting of a CheY-likereceiver domain and a winged-helix DNA-binding domain

DNA sequence :
ATGACTAACGTCCGTCGCATTCTGCTGGTCGAGGACGATGCCCACATCGCCGATCTGCTTTCGCTCCACCTTCGGGACGA
GGGGCTGGAGGTCGTGCATTGCGCCCGCGGCGACGACGGCCTCGCGCATCTGGAGCGCGGTGGCTGGGATGCGCTGGTGC
TGGATCTGATGTTGCCTGGCGTGGACGGCTTGGAGATATGCAGGCGTGCGCGTGCCATGACCCGCTACACGCCGATCATC
ATCATCAGTGCCCGCTCCAGTGAGGTGCATCGCATTCTGGGGCTGGAGATCGGCGCGGACGACTATCTGGCCAAGCCGTT
TTCCGTTCTGGAACTCGTGGCACGGGTGAAGGCTCTGCTGCGCCGGGTCGATGCTCTGGCTCAGAGTGCGCGCCTGGAAT
CCGGCAGCCTGTCGGTCAATGGGCTGGTCATGGACCCGGTGGCGCGGGAGGCCAGCCTGAGCGGGCGTCGTCTCGATCTC
ACGCCGCGCGAGTTCGATCTTCTGTATTTCTTTGCCCGCCAGTCGGGCAAGGTGTTCTCGCGCATGGACCTGCTCAATGC
GGTCTGGGGCTATCAGCACGAGGGCTACGAGCACACCGTCAACACCCATATCAACCGGCTTCGCGCCAAGGTGGAGCTCA
ATCCTGCACAGCCGACGCGGATCCTCACGGTTTGGGGGCGCGGCTACAAGTTCGCTGAGACTGGAGAGGGCGAATGA

Protein sequence :
MTNVRRILLVEDDAHIADLLSLHLRDEGLEVVHCARGDDGLAHLERGGWDALVLDLMLPGVDGLEICRRARAMTRYTPII
IISARSSEVHRILGLEIGADDYLAKPFSVLELVARVKALLRRVDALAQSARLESGSLSVNGLVMDPVAREASLSGRRLDL
TPREFDLLYFFARQSGKVFSRMDLLNAVWGYQHEGYEHTVNTHINRLRAKVELNPAQPTRILTVWGRGYKFAETGEGE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 6e-71 61
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 9e-71 60

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
CtCNB1_2722 YP_003278764.1 two component transcriptional regulator AE000516.2.gene3505. Protein 1e-35 46
CtCNB1_2722 YP_003278764.1 two component transcriptional regulator NC_012469.1.7685629. Protein 1e-41 43
CtCNB1_2722 YP_003278764.1 two component transcriptional regulator AF155139.2.orf0.gene Protein 3e-42 42
CtCNB1_2722 YP_003278764.1 two component transcriptional regulator HE999704.1.gene2815. Protein 6e-41 42
CtCNB1_2722 YP_003278764.1 two component transcriptional regulator AE015929.1.gene1106. Protein 9e-30 41
CtCNB1_2722 YP_003278764.1 two component transcriptional regulator HE999704.1.gene1528. Protein 3e-32 41
CtCNB1_2722 YP_003278764.1 two component transcriptional regulator NC_012469.1.7686381. Protein 5e-40 41
CtCNB1_2722 YP_003278764.1 two component transcriptional regulator BAC0039 Protein 1e-32 41
CtCNB1_2722 YP_003278764.1 two component transcriptional regulator CP001138.1.gene2239. Protein 9e-32 41
CtCNB1_2722 YP_003278764.1 two component transcriptional regulator CP000034.1.gene2186. Protein 1e-32 41
CtCNB1_2722 YP_003278764.1 two component transcriptional regulator NC_002695.1.916589.p Protein 1e-32 41
CtCNB1_2722 YP_003278764.1 two component transcriptional regulator BAC0596 Protein 9e-32 41
CtCNB1_2722 YP_003278764.1 two component transcriptional regulator CP001918.1.gene3444. Protein 3e-32 41
CtCNB1_2722 YP_003278764.1 two component transcriptional regulator CP001918.1.gene5135. Protein 7e-27 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
CtCNB1_2722 YP_003278764.1 two component transcriptional regulator VFG1563 Protein 3e-71 61
CtCNB1_2722 YP_003278764.1 two component transcriptional regulator VFG1702 Protein 4e-71 60
CtCNB1_2722 YP_003278764.1 two component transcriptional regulator VFG1389 Protein 4e-28 43