Gene Information

Name : CtCNB1_2473 (CtCNB1_2473)
Accession : YP_003278515.1
Strain : Comamonas testosteroni CNB-1
Genome accession: NC_013446
Putative virulence/resistance : Virulence
Product : two component heavy metal response transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2837177 - 2837869 bp
Length : 693 bp
Strand : +
Note : COG0745, OmpR, Response regulators consisting of a CheY-likereceiver domain and a winged-helix DNA-binding domain

DNA sequence :
ATGAAAATCCTGGTTGTAGAAGATGAGATCAAGCTCGCCGATTACCTAAACAAGGGTCTGGCGGAAGAGGGCTTCACTGT
GGATGTAGCCCACAACGGTATTGACGGTCTGCACCTGGCCAGTGAAATGGACTATGACCTGATCGTGCTTGACGGCATGC
TTCCGGGCATCGATGGCCTAGCCGTGCTAGCTGCGCTGAGGCAAACGAAACAAACACCTGTACTGATGTTGACTGCCCGT
GGCCAGGTTGAGGATCGCGTCAAGGGACTGCAGTGTGGCGCCGATGACTATCTCGTTAAGCCATTTGCATTTTCTGAACT
GGTCGCACGCCTGCATGTTCTATTACGGCGCAGTGGCCCCAGCGTTGCCCAAGCCGCCCCCGAAGCGACGACTCTGCGCT
TAGCTGACTTAGAGTTAGACCTAATTCGTCGTAGGGCCACGCGGGCGGGCCAGAGAATCGAGCTCACGGCCAAAGAGTTC
AATTTGCTTAGCCTTCTATTACGCCGCCAAGGGGAAGTGTTAACACGAACAGAGTTGGCATCTCAGGTTTGGGATATGAA
TTTCGACAGTGAGACCAACGTGGTAGAGGTCGCTATCCGACGCCTGCGGCTAAAGCTTGATCAGCCTTTTGAGCAACATC
TCCTCCACACCGTCCGTGGCATGGGCTATGTGCTCGAATCTCGCACAACATGA

Protein sequence :
MKILVVEDEIKLADYLNKGLAEEGFTVDVAHNGIDGLHLASEMDYDLIVLDGMLPGIDGLAVLAALRQTKQTPVLMLTAR
GQVEDRVKGLQCGADDYLVKPFAFSELVARLHVLLRRSGPSVAQAAPEATTLRLADLELDLIRRRATRAGQRIELTAKEF
NLLSLLLRRQGEVLTRTELASQVWDMNFDSETNVVEVAIRRLRLKLDQPFEQHLLHTVRGMGYVLESRTT

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 3e-56 55
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 2e-55 54

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
CtCNB1_2473 YP_003278515.1 two component heavy metal response transcriptional regulator BAC0197 Protein 7e-67 62
CtCNB1_2473 YP_003278515.1 two component heavy metal response transcriptional regulator BAC0083 Protein 9e-61 61
CtCNB1_2473 YP_003278515.1 two component heavy metal response transcriptional regulator BAC0125 Protein 2e-65 60
CtCNB1_2473 YP_003278515.1 two component heavy metal response transcriptional regulator BAC0638 Protein 2e-55 59
CtCNB1_2473 YP_003278515.1 two component heavy metal response transcriptional regulator BAC0111 Protein 9e-62 57
CtCNB1_2473 YP_003278515.1 two component heavy metal response transcriptional regulator BAC0308 Protein 7e-57 55
CtCNB1_2473 YP_003278515.1 two component heavy metal response transcriptional regulator BAC0347 Protein 5e-56 52
CtCNB1_2473 YP_003278515.1 two component heavy metal response transcriptional regulator HE999704.1.gene1528. Protein 3e-35 46
CtCNB1_2473 YP_003278515.1 two component heavy metal response transcriptional regulator CP000647.1.gene4257. Protein 1e-28 45
CtCNB1_2473 YP_003278515.1 two component heavy metal response transcriptional regulator BAC0533 Protein 1e-28 45
CtCNB1_2473 YP_003278515.1 two component heavy metal response transcriptional regulator CP001918.1.gene5135. Protein 3e-25 44
CtCNB1_2473 YP_003278515.1 two component heavy metal response transcriptional regulator CP000034.1.gene3834. Protein 2e-28 44
CtCNB1_2473 YP_003278515.1 two component heavy metal response transcriptional regulator CP001138.1.gene4273. Protein 6e-29 44
CtCNB1_2473 YP_003278515.1 two component heavy metal response transcriptional regulator NC_002695.1.915041.p Protein 2e-28 44
CtCNB1_2473 YP_003278515.1 two component heavy metal response transcriptional regulator NC_002516.2.879194.p Protein 8e-33 43
CtCNB1_2473 YP_003278515.1 two component heavy metal response transcriptional regulator NC_002952.2859858.p0 Protein 3e-38 42
CtCNB1_2473 YP_003278515.1 two component heavy metal response transcriptional regulator NC_007622.3794948.p0 Protein 3e-38 42
CtCNB1_2473 YP_003278515.1 two component heavy metal response transcriptional regulator NC_003923.1003417.p0 Protein 3e-38 42
CtCNB1_2473 YP_003278515.1 two component heavy metal response transcriptional regulator NC_013450.8614146.p0 Protein 3e-38 42
CtCNB1_2473 YP_003278515.1 two component heavy metal response transcriptional regulator NC_002951.3238224.p0 Protein 3e-38 42
CtCNB1_2473 YP_003278515.1 two component heavy metal response transcriptional regulator NC_007793.3914065.p0 Protein 3e-38 42
CtCNB1_2473 YP_003278515.1 two component heavy metal response transcriptional regulator NC_002758.1121390.p0 Protein 3e-38 42
CtCNB1_2473 YP_003278515.1 two component heavy metal response transcriptional regulator NC_010079.5776364.p0 Protein 3e-38 42
CtCNB1_2473 YP_003278515.1 two component heavy metal response transcriptional regulator AE015929.1.gene1106. Protein 4e-34 41
CtCNB1_2473 YP_003278515.1 two component heavy metal response transcriptional regulator NC_002952.2859905.p0 Protein 2e-32 41
CtCNB1_2473 YP_003278515.1 two component heavy metal response transcriptional regulator NC_002745.1124361.p0 Protein 2e-32 41
CtCNB1_2473 YP_003278515.1 two component heavy metal response transcriptional regulator NC_009782.5559369.p0 Protein 2e-32 41
CtCNB1_2473 YP_003278515.1 two component heavy metal response transcriptional regulator NC_002951.3237708.p0 Protein 2e-32 41
CtCNB1_2473 YP_003278515.1 two component heavy metal response transcriptional regulator NC_003923.1003749.p0 Protein 2e-32 41
CtCNB1_2473 YP_003278515.1 two component heavy metal response transcriptional regulator NC_002758.1121668.p0 Protein 2e-32 41
CtCNB1_2473 YP_003278515.1 two component heavy metal response transcriptional regulator NC_007622.3794472.p0 Protein 2e-32 41
CtCNB1_2473 YP_003278515.1 two component heavy metal response transcriptional regulator NC_009641.5332272.p0 Protein 2e-32 41
CtCNB1_2473 YP_003278515.1 two component heavy metal response transcriptional regulator NC_013450.8614421.p0 Protein 2e-32 41
CtCNB1_2473 YP_003278515.1 two component heavy metal response transcriptional regulator NC_007793.3914279.p0 Protein 2e-32 41
CtCNB1_2473 YP_003278515.1 two component heavy metal response transcriptional regulator CP004022.1.gene3215. Protein 5e-30 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
CtCNB1_2473 YP_003278515.1 two component heavy metal response transcriptional regulator VFG0596 Protein 1e-56 55
CtCNB1_2473 YP_003278515.1 two component heavy metal response transcriptional regulator VFG1389 Protein 1e-39 46
CtCNB1_2473 YP_003278515.1 two component heavy metal response transcriptional regulator VFG1390 Protein 2e-42 44
CtCNB1_2473 YP_003278515.1 two component heavy metal response transcriptional regulator VFG1386 Protein 2e-37 42
CtCNB1_2473 YP_003278515.1 two component heavy metal response transcriptional regulator VFG0473 Protein 1e-30 41