Gene Information

Name : Gbro_4751 (Gbro_4751)
Accession : YP_003275762.1
Strain : Gordonia bronchialis DSM 43247
Genome accession: NC_013441
Putative virulence/resistance : Resistance
Product : stress protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG2310
EC number : -
Position : 5083834 - 5084502 bp
Length : 669 bp
Strand : +
Note : PFAM: stress protein; KEGG: ypb:YPTS_0380 stress protein

DNA sequence : 
ATGCCCGATTTCACATACAGTGTTGGCGAAACCGGCAAAACGTTCGGCGCCGGTTCCGCGATCACCGATGAACGCAACGA
AAGGCGCTTCAACATGGGCGTAAGCCTCAGCAAGGGCGGAAATGTCTCGCTGACCAAGGAGGCACCCGGCCTGACCGCGG
TCTCCGTGGGTCTGGGATGGGACATCCGCACCACCACCGGCACCGACTTCGACCTGGATGCCAGCGCCATCGCGCTCGGC
GCGAACAAGAAGGTGCTGTCGGACGCCCACTTCATCTTCTTCAACAACCTGCGGTCGCCGGACGGCTCCATCGAGCACAC
CGGTGACAACCTGACCGGCGAGGGTGAGGGCGACGACGAGGTCATCAAGGTCGACCTCAACGGGGTCCCGCCGGAGGTCG
ACTCCATCGTCTTTCCCGTCTCCATCTACGACGCCGACGCCCGCAGCCAGTCCTTCGGTCAGGTGCGCAACGCGTTCATC
CGCGTCGTCAATCAGGCCGGTGGCGCCGAGATCGCCCGCTACGACCTGTCCGAGGACGCCTCCACCGAGACCGCGATGGT
CTTCGGTGAGCTGTACCGGAACGGCGCCGAGTGGAAGTTCCGCGCCGTCGGCCAGGGTTATGCGTCGGGCCTCGCGGGGA
TCGCCCGCGACTTCGGCGTGAACGTCTGA

Protein sequence : 
MPDFTYSVGETGKTFGAGSAITDERNERRFNMGVSLSKGGNVSLTKEAPGLTAVSVGLGWDIRTTTGTDFDLDASAIALG
ANKKVLSDAHFIFFNNLRSPDGSIEHTGDNLTGEGEGDDEVIKVDLNGVPPEVDSIVFPVSIYDADARSQSFGQVRNAFI
RVVNQAGGAEIARYDLSEDASTETAMVFGELYRNGAEWKFRAVGQGYASGLAGIARDFGVNV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 9e-60 67
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-59 67
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-59 67
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-59 67
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-59 67
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 3e-60 66
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 1e-55 66
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 4e-59 66
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 7e-33 45
terZ NP_286706.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 4e-29 42
terZ_2 NP_287114.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 4e-29 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Gbro_4751 YP_003275762.1 stress protein BAC0389 Protein 6e-59 66
Gbro_4751 YP_003275762.1 stress protein BAC0390 Protein 3e-59 64
Gbro_4751 YP_003275762.1 stress protein BAC0392 Protein 2e-28 41