Gene Information

Name : Hoch_2836 (Hoch_2836)
Accession : YP_003267253.1
Strain : Haliangium ochraceum DSM 14365
Genome accession: NC_013440
Putative virulence/resistance : Resistance
Product : MerR family transcriptional regulator
Function : -
COG functional category : K : Transcription
COG ID : COG0789
EC number : -
Position : 3887972 - 3888379 bp
Length : 408 bp
Strand : +
Note : PFAM: transcription regulator MerR DNA binding; regulatory protein MerR; SMART: regulatory protein MerR; KEGG: pap:PSPA7_0115 Hg(II)-responsive transcriptional regulator

DNA sequence :
ATGACCACGCTGACGATCGGAAAAGTCGCAAAAGCCGCCGGCCTCGGAGTCGAGACGGTCCGCTTCTACGAGCGCCAGGG
GCTCATCGCCGAGCCCGCCCGTTCCGATTCGGGCTACCGCCAGTATGGCCCCGAGACGATCCGGCGGCTCCAGTTCATCG
TCCGCGCGAAGGCGCTGGGCTTCACCCTGCAGGAGATCGGTGACCTCCTCGACCTGCGGGCGACGCCGGGAGCGGGTTGC
GCCGATGTGCAGGCGCGCGCCGAGGCGAAGATTGCCGACATCGAGGAGCGCATCACCCAGCTCGACGCGATGAAGCGCGC
CCTCGGTGAGCTCGTCGTCCAGTGCCGCGGCGAAGGTCCACTCAGCGACTGCCCGATCCTCGACGCCCTCGATGAGGAGG
CGCCATGA

Protein sequence :
MTTLTIGKVAKAAGLGVETVRFYERQGLIAEPARSDSGYRQYGPETIRRLQFIVRAKALGFTLQEIGDLLDLRATPGAGC
ADVQARAEAKIADIEERITQLDAMKRALGELVVQCRGEGPLSDCPILDALDEEAP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
EXB37 ABD94723.1 putative regulator of mercury resistance conferring proteins Not tested ExoU island B Protein 2e-27 43
ORF C98 AAN62191.1 putative transcriptional regulator Not tested PAGI-2(C) Protein 1e-22 42
SE0081 NP_763636.1 hypothetical protein Not tested SCCpbp4 Protein 7e-22 42
unnamed BAB47646.1 orf2 Not tested Type-III SCCmec Protein 5e-22 42
merR AFG30124.1 MerR Not tested PAGI-2 Protein 2e-23 41
merR YP_006098391.1 mercuric resistance operon transcriptional regulator Not tested Tn2411 Protein 3e-23 41
merR AGK07025.1 MerR Not tested SGI1 Protein 3e-23 41
merR AGK07083.1 MerR Not tested SGI1 Protein 3e-23 41
merR ACK44535.1 MerR Not tested SGI1 Protein 2e-23 41
merR AET25401.1 MerR Not tested PAGI-2(C) Protein 2e-23 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Hoch_2836 YP_003267253.1 MerR family transcriptional regulator BAC0301 Protein 1e-21 44
Hoch_2836 YP_003267253.1 MerR family transcriptional regulator BAC0680 Protein 4e-22 42
Hoch_2836 YP_003267253.1 MerR family transcriptional regulator BAC0682 Protein 3e-24 41
Hoch_2836 YP_003267253.1 MerR family transcriptional regulator BAC0686 Protein 1e-24 41
Hoch_2836 YP_003267253.1 MerR family transcriptional regulator BAC0058 Protein 2e-24 41