Name : Hneap_1211 (Hneap_1211) Accession : YP_003263094.1 Strain : Halothiobacillus neapolitanus c2 Genome accession: NC_013422 Putative virulence/resistance : Resistance Product : mercuric transporter periplasmic component Function : - COG functional category : P : Inorganic ion transport and metabolism COG ID : COG2608 EC number : - Position : 1315824 - 1316099 bp Length : 276 bp Strand : - Note : TIGRFAM: mercuric transporter periplasmic component; PFAM: Heavy metal transport/detoxification protein; KEGG: dia:Dtpsy_2131 mercuric transporter periplasmic component DNA sequence : ATGAAGAAACTGTTTGCCTCCCTTGCCCTCGCCGCCGTTGTTGCTCCCGTGTGGGCCGCTACCCAAACCGTCACGCTAGC GGTGCCCGGCATGACCTGCGCCGCCTGCCCGATTACCGTCAAGAAAGCGCTCTCCAAGGTCGAGGGCGTGAGCAAGGTCG ATGTGGGCTTCGAGAAACGCGAGGCTGTCGTCACTTTCGACAACGCCAAGACCAGCGTGCCGAAGCTCACCAAGGCCACC GAAGACGCCGGCTATCCGTCCAGCGTCAAGCAGTGA Protein sequence : MKKLFASLALAAVVAPVWAATQTVTLAVPGMTCAACPITVKKALSKVEGVSKVDVGFEKREAVVTFDNAKTSVPKLTKAT EDAGYPSSVKQ |
Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
merP | ABQ57373.1 | MerP | Not tested | SGI1 | Protein | 3e-25 | 93 |
merP | AET25399.1 | MerP | Not tested | PAGI-2(C) | Protein | 3e-25 | 93 |
merP | AFG30122.1 | MerP | Not tested | PAGI-2 | Protein | 3e-25 | 93 |
merP | AGK07023.1 | MerP | Not tested | SGI1 | Protein | 3e-25 | 93 |
merP | AGK07081.1 | MerP | Not tested | SGI1 | Protein | 3e-25 | 93 |
merP | YP_006098389.1 | mercuric ion transport protein | Not tested | Tn2411 | Protein | 5e-25 | 93 |
merP | ACN81007.1 | MerP periplasmic mercuric ion binding protein | Not tested | AbaR5 | Protein | 1e-23 | 84 |
merP | CAJ77062.1 | Periplasmic mercuric ion binding protein | Not tested | AbaR1 | Protein | 9e-24 | 84 |
unnamed | ABR13399.1 | copper-transporting ATPase 2 | Not tested | PAGI-5 | Protein | 2e-23 | 79 |
merP | AAN62179.1 | periplasmic mercuric ion binding protein MerP | Not tested | PAGI-2(C) | Protein | 2e-21 | 79 |
Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
Hneap_1211 | YP_003263094.1 | mercuric transporter periplasmic component | BAC0679 | Protein | 1e-23 | 89 |
Hneap_1211 | YP_003263094.1 | mercuric transporter periplasmic component | BAC0678 | Protein | 4e-24 | 88 |
Hneap_1211 | YP_003263094.1 | mercuric transporter periplasmic component | BAC0231 | Protein | 5e-24 | 88 |
Hneap_1211 | YP_003263094.1 | mercuric transporter periplasmic component | BAC0675 | Protein | 3e-20 | 72 |
Hneap_1211 | YP_003263094.1 | mercuric transporter periplasmic component | BAC0674 | Protein | 4e-17 | 61 |