Gene Information

Name : Pecwa_0447 (Pecwa_0447)
Accession : YP_003257894.1
Strain : Pectobacterium wasabiae WPP163
Genome accession: NC_013421
Putative virulence/resistance : Unknown
Product : integrase
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG0582
EC number : -
Position : 483089 - 484348 bp
Length : 1260 bp
Strand : +
Note : PFAM: integrase; KEGG: dze:Dd1591_3702 integrase

DNA sequence :
ATGGCGCTGACTGACGTTGTTGCCCGTACTGCCAAGCCTCGCGAAAAAGCCTATAAGCTCGCTGACGCGCACGGCCTGTA
TCTTTTGGTGAGTCCTAACGGCTCTAAGCGCTGGTATCTCAAATACCGCTTTGAAGGTAAGGAAAGCCGGATTGCGTTCG
GTGCCTATCCGCTGATCTCGCTGGCAAAGGCCAGAGAGAAACGTGATGAGATACGATTGCTGCTGTTGGAGGGTATCCAC
CCAACGGAAAAGCGTGAAGAAGAAAAAGAGCAGGCGCAAGAAGCGTTGAATACTTTTGCGAAGGTCGCGCAGGACTGGCA
CCGAAATATTAGCCAAAACAGATGGTCAGAAACGCACGCCGGACGGGTATGGCGCGATATGGAACGAAATCTCCTGCCTG
CTATTGGGCATCGCCATATTGCCGATCTGAAAACTAAAGACCTGCTGGAGCCGCTGAAAGCCGTCGAACAGAACGGTCAT
CTTGATTTGGCGTCACGGCTGCGCCAGCGTGTCACCGATATCATGCGTTACGCGGTGCAGAACGATCTGATAGAGCGCAA
CCCCGCGCAAGACCTCTCCGGGGCGATAGCCGCACCAAAAGCTACCCATCGGCCAGCCCTGAAGCTGAATAAACTGCCTG
ATTTTCTGGCAAGGATTGAACGCCACAAAGGGAGGACGTTAACCAGACTGGCCTTAAAACTCACGCTGTGCGTTTTTATC
CGTTCCAGCGAGCTACGTTTTGCCCGCTGGCCGGAAATCGATTTTAAACGTGCCATGTGGACGATACCGGCTGAACGTGA
AGCTATCCCCGGCGTGAAGCACTCACAGCGCGGCGCAAAGATGCGCTCTGAACATCTGGTGCCGTTATCCCGACAGGCTT
TAGCGCTGCTGGAAGAGATTAAGGCCATCAGCGGTGCTCATGAACTGATTTTCCCCGGCGATCGTCGACCAACTAAACCG
ATGAGTGAAAACACCGTCAACAACGCATTACGAACCATGGGCTATGACACCACCATAGAAGTTTGCGGACACGGCTTTCG
CACGATGGCCTGTAGCGCACTGGTGGAGTCCGGCCAGTGGTCACGGGATGCGGTAGAGCGCCAGATGAGTCATCAGGAAC
GCAACGGTGTCCGTGCTGCCTATATCCACAAAGCGGAACATCTGGATGAGCGTAGGCTAATGCTGCAATGGTGGGCGGAT
TATCTGGATGCGAATCGGGAAGAGTATGTGGTGCCGTATGAGTTTAAGAGAGCTTACTAA

Protein sequence :
MALTDVVARTAKPREKAYKLADAHGLYLLVSPNGSKRWYLKYRFEGKESRIAFGAYPLISLAKAREKRDEIRLLLLEGIH
PTEKREEEKEQAQEALNTFAKVAQDWHRNISQNRWSETHAGRVWRDMERNLLPAIGHRHIADLKTKDLLEPLKAVEQNGH
LDLASRLRQRVTDIMRYAVQNDLIERNPAQDLSGAIAAPKATHRPALKLNKLPDFLARIERHKGRTLTRLALKLTLCVFI
RSSELRFARWPEIDFKRAMWTIPAEREAIPGVKHSQRGAKMRSEHLVPLSRQALALLEEIKAISGAHELIFPGDRRPTKP
MSENTVNNALRTMGYDTTIEVCGHGFRTMACSALVESGQWSRDAVERQMSHQERNGVRAAYIHKAEHLDERRLMLQWWAD
YLDANREEYVVPYEFKRAY

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
intB CAD42017.1 bacteriophage P4 integrase Not tested PAI II 536 Protein 2e-113 63
SESS1296_03598 AFO66301.1 bacteriophage integrase Not tested SESS LEE Protein 2e-116 61
SESS1635_03816 AFO66367.1 bacteriophage integrase Not tested SESS LEE Protein 2e-116 61
ECO111_3718 YP_003236059.1 putative integrase Not tested LEE Protein 2e-113 59
c5216 NP_757064.1 prophage P4 integrase Not tested PAI II CFT073 Protein 2e-114 59
c3556 NP_755431.1 prophage P4 integrase Not tested PAI I CFT073 Protein 2e-114 59
ECUMN_3322 YP_002414004.1 integrase Not tested Not named Protein 5e-113 59
ORF_1 AAZ04412.1 phage integrase Not tested PAI I APEC-O1 Protein 2e-114 59
S4822 NP_838459.1 P4-type integrase Not tested SHI-1 Protein 4e-114 59
SF2964 NP_708738.1 P4-type integrase Not tested SHI-1 Protein 4e-114 59
APECO1_3534 YP_854214.1 P4-like integrase Not tested PAI I APEC-O1 Protein 2e-114 59
int AAK00456.1 Int Not tested SHI-1 Protein 4e-106 59
int AAL51028.1 CP4-like integrase Not tested LEE Protein 2e-115 59
int-phe AAL60261.1 Int-phe Not tested LEE Protein 2e-115 59
intP4 CAE85151.1 CP4 integrase protein Not tested PAI V 536 Protein 2e-115 59
int AAK16198.1 Int Not tested PAI-I AL862 Protein 2e-115 59
ECO103_3550 YP_003223418.1 integrase Not tested LEE Protein 3e-115 59
int ADD91747.1 P4 integrase Not tested PAI-I AL862 Protein 2e-115 59
ECO26_5300 YP_003232178.1 integrase Not tested LEE Protein 3e-115 59
int AAL51003.1 CP4-like integrase Not tested LEE Protein 1e-114 59
int AAT48697.1 CP4-like integrase Not tested PAI I 4787 Protein 1e-114 59
int-phe AAL57571.1 CP4-like integrase Not tested LEE Protein 2e-115 59
int CAC81896.1 integrase Not tested LEE II Protein 3e-107 58
Z4313 NP_289539.1 pathogenicity island integrase Not tested OI-122 Protein 1e-114 58
STY4821 NP_458899.1 integrase Not tested SPI-10 Protein 3e-106 57
int CAB59974.1 integrase Not tested HPI Protein 5e-107 56
y2393 NP_669700.1 prophage integrase Not tested HPI Protein 1e-106 56
int CAA08754.1 integrase Not tested HPI Protein 3e-107 56
int2 NP_993013.1 integrase Not tested HPI Protein 1e-106 56
int CAA21384.1 - Not tested HPI Protein 1e-106 56
int YP_002346908.1 integrase Not tested HPI Protein 1e-106 56
int NP_458759.1 bacteriophage integrase Not tested SPI-7 Protein 7e-106 56
int NP_807963.1 bacteriophage integrase Not tested SPI-7 Protein 7e-106 56
APECO1_1051 YP_853069.1 phage integrase Not tested PAI IV APEC-O1 Protein 4e-72 56
intB AAD37509.1 P4-like integrase Not tested PAI IV 536 Protein 2e-87 56
unnamed AAD17660.1 unknown Not tested HPI Protein 3e-103 54
unnamed ABR13507.1 phage integrase Not tested PAGI-6 Protein 5e-99 54
unnamed AFX83955.1 integrase Not tested SE-PAI Protein 4e-64 42
int ACU09430.1 integrase Not tested LEE Protein 3e-68 42
intL NP_290239.1 integrase for prophage 933L and the LEE pathogenicity island Not tested LEE Protein 4e-68 42
ECs4534 NP_312561.1 integrase Not tested LEE Protein 4e-68 42
int AAC31482.1 CP4-like integrase Not tested LEE Protein 3e-68 42
int AAD44730.1 Int Not tested SHI-2 Protein 9e-69 42
int CAC39282.1 integrase Not tested LPA Protein 6e-69 42
aec33 AAW51716.1 Int Not tested AGI-3 Protein 5e-69 42
SF3698 NP_709437.1 integrase Not tested SHI-2 Protein 3e-67 41
int AAD54663.1 Sai integrase Not tested SHI-2 Protein 2e-67 41
S4835 NP_839238.1 integrase Not tested SHI-2 Protein 3e-67 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Pecwa_0447 YP_003257894.1 integrase VFG1536 Protein 1e-113 63
Pecwa_0447 YP_003257894.1 integrase VFG0626 Protein 2e-114 59
Pecwa_0447 YP_003257894.1 integrase VFG1693 Protein 8e-115 59
Pecwa_0447 YP_003257894.1 integrase VFG0783 Protein 1e-68 42
Pecwa_0447 YP_003257894.1 integrase VFG0598 Protein 1e-67 41