Gene Information

Name : Pecwa_3698 (Pecwa_3698)
Accession : YP_003261040.1
Strain : Pectobacterium wasabiae WPP163
Genome accession: NC_013421
Putative virulence/resistance : Resistance
Product : stress protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG2310
EC number : -
Position : 4071528 - 4072106 bp
Length : 579 bp
Strand : +
Note : PFAM: stress protein; KEGG: kpe:KPK_A0198 tellurium resistance protein TerD

DNA sequence :
ATGAGCGTTTCTCTTTCTAAAGGCGGTAATGTCTCACTGAGCAAAGCAGCACCGACGATGAAAAATGTCTTAGTCGGTCT
TGGCTGGGATGCACGCGCGACGGATGGTCAGGACTTTGACCTGGATGCGTCAGCATTCCTGCTCAATGCGAATGGCAAAG
TCCGTGGTGATACCGACTTCATTTTCTACAATAACTTGAAGTCTGCTGATGGCTCAGTGGCCCACACCGGCGATAACCGT
ACAGGCGCGGGTGATGGAGATGACGAATCATTGAAAATTAAGCTGGATCTGATTCCGGCTGAGGTCGACAAAATCGTTTT
CGTTGTCACTATCCATGATGCACAGGTCCGTAACCAGAGCTTTGGTCAGGTATCCGGCGCGTTCATTCGCCTGGCAAACG
ATGACACCCAAGCCGAGATCGCACGCTACGACCTGACTGAAGATGCTTCCACTGAAACCGCCATGCTGTTCGGTGAACTG
TATCGTCATAATACGGAGTGGAAATTCCGTGCCGTCGGTCAGGGCTATGCAGGTGGTTTGGCATCGGTCTGCTCACAATA
CGGTATCAACGCATCCTGA

Protein sequence :
MSVSLSKGGNVSLSKAAPTMKNVLVGLGWDARATDGQDFDLDASAFLLNANGKVRGDTDFIFYNNLKSADGSVAHTGDNR
TGAGDGDDESLKIKLDLIPAEVDKIVFVVTIHDAQVRNQSFGQVSGAFIRLANDDTQAEIARYDLTEDASTETAMLFGEL
YRHNTEWKFRAVGQGYAGGLASVCSQYGINAS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-79 90
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-79 90
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 5e-79 89
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 3e-66 69
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 1e-58 65
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-58 65
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-58 65
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 2e-56 64

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Pecwa_3698 YP_003261040.1 stress protein BAC0389 Protein 5e-79 89
Pecwa_3698 YP_003261040.1 stress protein BAC0390 Protein 5e-62 66