Gene Information

Name : Pecwa_3183 (Pecwa_3183)
Accession : YP_003260532.1
Strain : Pectobacterium wasabiae WPP163
Genome accession: NC_013421
Putative virulence/resistance : Resistance
Product : arsenate reductase
Function : -
COG functional category : P : Inorganic ion transport and metabolism
COG ID : COG1393
EC number : -
Position : 3467068 - 3467445 bp
Length : 378 bp
Strand : +
Note : TIGRFAM: arsenate reductase; PFAM: arsenate reductase and related; KEGG: eca:ECA1258 arsenate reductase

DNA sequence : 
ATGACACTGCTTTCAACCAAAGCATCCGTGACGATTTACCACAACCCGCGCTGCTCAAAAAGCCGTGAAACGCTGGCGCT
ACTGCAAGAGCACAAGATTGCCCCTGACGTCGTGCTCTATCTCGACACGCCGCCCGATGCCGCAACGCTGGCTCAGCTTA
TCCAGCAGTTGGGCTTTAGCAGCGCACGCGAGTTGATGAGAACCAACGAAGAGAGTTATCAGCAGTTGGGGCTATCGGAC
GCTGCGCTGACGGAAGCGCAACTTATTCAGGCGATGATCGATAACCCGAAACTCATCGAGCGTCCTATCGTCGTGGCACA
GGGCCAGGCACGTATTGGCCGCCCGCCGGAGCAGGTGTTGGAAATTCTGTCGTTGTGA

Protein sequence : 
MTLLSTKASVTIYHNPRCSKSRETLALLQEHKIAPDVVLYLDTPPDAATLAQLIQQLGFSSARELMRTNEESYQQLGLSD
AALTEAQLIQAMIDNPKLIERPIVVAQGQARIGRPPEQVLEILSL

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
arsC ADZ05768.1 arsenate reductase Not tested AbaR11 Protein 2e-23 46
arsC2 YP_001007634.1 arsenate reductase Not tested YAPI Protein 1e-24 46
arsR CAJ77019.1 arsenate reductase Not tested AbaR1 Protein 1e-23 46
arsC AFC76436.1 ArsC Not tested AbaR5 Protein 2e-23 46

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Pecwa_3183 YP_003260532.1 arsenate reductase BAC0583 Protein 3e-26 47
Pecwa_3183 YP_003260532.1 arsenate reductase BAC0582 Protein 7e-26 46
Pecwa_3183 YP_003260532.1 arsenate reductase BAC0584 Protein 2e-24 45
Pecwa_3183 YP_003260532.1 arsenate reductase BAC0585 Protein 2e-25 44