|
Name : rpmE (D11S_0431) Accession : YP_003255060.1 Strain : Aggregatibacter actinomycetemcomitans D11S-1 Genome accession: NC_013416 Putative virulence/resistance : Unknown Product : 50S ribosomal protein L31 Function : - COG functional category : J : Translation, ribosomal structure and biogenesis COG ID : COG0254 EC number : - Position : 394618 - 394830 bp Length : 213 bp Strand : + Note : RpmE; there appears to be two types of ribosomal proteins L31 in bacterial genomes; some contain a CxxC motif while others do not; Bacillus subtilis has both types; the proteins in this cluster have the CXXC motif; RpmE is found in exponentially growing B DNA sequence : ATGAAACAAGGTATTCATCCTGAATATAAAGAGGTTACTGCGACCTGTTCTTGCGGTAACGTGATCAAAACCCGTTCAAC CTTAGGCAAAGACATTAACCTTGATGTGTGCGGTAAATGTCACCCATTCTACACAGGAAAACAACGTGTTGTTGACACCG GTGGCCGCGTTGAACGCTTTAACAGCCGTTTTAAAATTCCAGGTACAAAATAA Protein sequence : MKQGIHPEYKEVTATCSCGNVIKTRSTLGKDINLDVCGKCHPFYTGKQRVVDTGGRVERFNSRFKIPGTK |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| rpmE2 | NP_286687.1 | 50S ribosomal protein L31 | Not tested | TAI | Protein | 3e-08 | 41 |
| rpmE2 | NP_287095.1 | 50S ribosomal protein L31 | Not tested | TAI | Protein | 3e-08 | 41 |
