Gene Information

Name : Adeg_1897 (Adeg_1897)
Accession : YP_003239827.1
Strain : Ammonifex degensii KC4
Genome accession: NC_013385
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator, winged helix family
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1898883 - 1899572 bp
Length : 690 bp
Strand : -
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver; KEGG: bxe:Bxe_B0815 two component transcriptional regulator

DNA sequence :
ATGGTGACCGCAAAGATTCTAGTGGTGGAAGACGATCCCAGAATCAGGGAGATTATAACACGGATATTGAGCTGCGAGGG
CTACCAGGTTATTACCAGTACCGGAGGCTGGGAAGCCCTAACTCGGGTACAGAAAGAAAGTCCCGACCTGGTCATTTTGG
ATCTCTGGTTGCCGGACCTAGACGGGCTAGAGGTTTGCCGGCAGCTCAGGGCCAAATATGCGATTCCCGTGATCATTGTT
TCTGCCCGAGGGGAAGAAGCGGATAAAATTGCTGGCTTCACTTTGGGTGCCGACGATTACGTGACCAAGCCCTTTAGTCC
TGCGGAACTGGTTCTGCGAGTAAAGGCGGTTTTGCGCCGGGTACAAGGGTCGGACTCCTGGAAGGGGCGGGAGGTAATAA
GGGTACGTGGGTTGGTGATCGATCGGGCTTCACGTACAGTGGAGCTTAACGGAGTACCGATAAATCTAACCGCGCGGGAA
TTCGATCTGCTTTGGATCTTGGCTAGCCACCCTAATCGGGTCTTTAGCCGGGATCAGCTTCTCAACCTGGTCTGGAAGAA
TGAGTTTGGAGCTGACCCGGCTACGGTTACCGTCCTCATCCGGCGGTTGAGGCAGAAGTTGGAAAAGGATCCGGAAAAGC
CGGAGCTCATCAAGACCGTGTGGGGAGTGGGCTATAAGTTTCAGGCGTAG

Protein sequence :
MVTAKILVVEDDPRIREIITRILSCEGYQVITSTGGWEALTRVQKESPDLVILDLWLPDLDGLEVCRQLRAKYAIPVIIV
SARGEEADKIAGFTLGADDYVTKPFSPAELVLRVKAVLRRVQGSDSWKGREVIRVRGLVIDRASRTVELNGVPINLTARE
FDLLWILASHPNRVFSRDQLLNLVWKNEFGADPATVTVLIRRLRQKLEKDPEKPELIKTVWGVGYKFQA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 3e-33 45
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 1e-32 45
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 3e-27 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Adeg_1897 YP_003239827.1 two component transcriptional regulator, winged helix family AE000516.2.gene3505. Protein 5e-38 46
Adeg_1897 YP_003239827.1 two component transcriptional regulator, winged helix family AF155139.2.orf0.gene Protein 2e-41 44
Adeg_1897 YP_003239827.1 two component transcriptional regulator, winged helix family EU250284.1.orf4.gene Protein 2e-36 44
Adeg_1897 YP_003239827.1 two component transcriptional regulator, winged helix family FJ349556.1.orf0.gene Protein 1e-42 44
Adeg_1897 YP_003239827.1 two component transcriptional regulator, winged helix family NC_012469.1.7685629. Protein 9e-40 44
Adeg_1897 YP_003239827.1 two component transcriptional regulator, winged helix family NC_002952.2859905.p0 Protein 1e-38 43
Adeg_1897 YP_003239827.1 two component transcriptional regulator, winged helix family NC_007793.3914279.p0 Protein 2e-38 43
Adeg_1897 YP_003239827.1 two component transcriptional regulator, winged helix family NC_003923.1003749.p0 Protein 1e-38 43
Adeg_1897 YP_003239827.1 two component transcriptional regulator, winged helix family NC_002745.1124361.p0 Protein 2e-38 43
Adeg_1897 YP_003239827.1 two component transcriptional regulator, winged helix family NC_009782.5559369.p0 Protein 2e-38 43
Adeg_1897 YP_003239827.1 two component transcriptional regulator, winged helix family NC_002951.3237708.p0 Protein 2e-38 43
Adeg_1897 YP_003239827.1 two component transcriptional regulator, winged helix family NC_002758.1121668.p0 Protein 2e-38 43
Adeg_1897 YP_003239827.1 two component transcriptional regulator, winged helix family NC_007622.3794472.p0 Protein 1e-38 43
Adeg_1897 YP_003239827.1 two component transcriptional regulator, winged helix family NC_009641.5332272.p0 Protein 2e-38 43
Adeg_1897 YP_003239827.1 two component transcriptional regulator, winged helix family NC_013450.8614421.p0 Protein 2e-38 43
Adeg_1897 YP_003239827.1 two component transcriptional regulator, winged helix family CP000034.1.gene3671. Protein 2e-34 43
Adeg_1897 YP_003239827.1 two component transcriptional regulator, winged helix family AE015929.1.gene1106. Protein 9e-31 42
Adeg_1897 YP_003239827.1 two component transcriptional regulator, winged helix family AF162694.1.orf4.gene Protein 1e-35 42
Adeg_1897 YP_003239827.1 two component transcriptional regulator, winged helix family HE999704.1.gene2815. Protein 6e-37 42
Adeg_1897 YP_003239827.1 two component transcriptional regulator, winged helix family NC_007622.3794948.p0 Protein 2e-34 41
Adeg_1897 YP_003239827.1 two component transcriptional regulator, winged helix family NC_003923.1003417.p0 Protein 2e-34 41
Adeg_1897 YP_003239827.1 two component transcriptional regulator, winged helix family NC_013450.8614146.p0 Protein 2e-34 41
Adeg_1897 YP_003239827.1 two component transcriptional regulator, winged helix family NC_002951.3238224.p0 Protein 2e-34 41
Adeg_1897 YP_003239827.1 two component transcriptional regulator, winged helix family NC_007793.3914065.p0 Protein 2e-34 41
Adeg_1897 YP_003239827.1 two component transcriptional regulator, winged helix family NC_002758.1121390.p0 Protein 2e-34 41
Adeg_1897 YP_003239827.1 two component transcriptional regulator, winged helix family NC_010079.5776364.p0 Protein 2e-34 41
Adeg_1897 YP_003239827.1 two component transcriptional regulator, winged helix family NC_002952.2859858.p0 Protein 2e-34 41
Adeg_1897 YP_003239827.1 two component transcriptional regulator, winged helix family NC_012469.1.7686381. Protein 2e-34 41
Adeg_1897 YP_003239827.1 two component transcriptional regulator, winged helix family NC_005054.2598277.p0 Protein 1e-36 41
Adeg_1897 YP_003239827.1 two component transcriptional regulator, winged helix family NC_014475.1.orf0.gen Protein 1e-36 41
Adeg_1897 YP_003239827.1 two component transcriptional regulator, winged helix family AE016830.1.gene1681. Protein 2e-33 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Adeg_1897 YP_003239827.1 two component transcriptional regulator, winged helix family VFG1389 Protein 1e-30 47
Adeg_1897 YP_003239827.1 two component transcriptional regulator, winged helix family VFG1563 Protein 1e-33 45
Adeg_1897 YP_003239827.1 two component transcriptional regulator, winged helix family VFG1702 Protein 4e-33 45
Adeg_1897 YP_003239827.1 two component transcriptional regulator, winged helix family VFG1390 Protein 2e-32 42
Adeg_1897 YP_003239827.1 two component transcriptional regulator, winged helix family VFG0596 Protein 1e-27 41