
|
Name : ECO111_1271 (ECO111_1271) Accession : YP_003233763.1 Strain : Escherichia coli 11128 Genome accession: NC_013364 Putative virulence/resistance : Virulence Product : putative DNA binding protein Function : - COG functional category : K : Transcription COG ID : COG3311 EC number : - Position : 1317248 - 1317445 bp Length : 198 bp Strand : + Note : Integrative element ECO111_IE02 DNA sequence : ATGTTGACTACAACAAGCCACGACAGCGTATTTCTGCGTGCCGATAATTCCCTGATCGACATGAACTATATCACCAGTTT CACCGGTATGACCGACAAATGGTTTTACAAGTTGATCAGTGAAGGCCATTTCCCTAAACCCATCAAACTGGGGCGCAGCA GCCGCTGGTACAAAAGTGAAGTGGAGCAGTGGAAGTGA Protein sequence : MLTTTSHDSVFLRADNSLIDMNYITSFTGMTDKWFYKLISEGHFPKPIKLGRSSRWYKSEVEQWK |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| Z1188 | NP_286723.1 | hypothetical protein | Not tested | TAI | Protein | 1e-25 | 100 |
| Z1627 | NP_287131.1 | hypothetical protein | Not tested | TAI | Protein | 1e-25 | 100 |
| unnamed | CAD33739.1 | hypothetical protein | Not tested | PAI I 536 | Protein | 4e-25 | 96 |
| c5192 | NP_757040.1 | hypothetical protein | Not tested | PAI II CFT073 | Protein | 6e-25 | 96 |
| rox | AAR97599.1 | regulator of excision | Not tested | SHI-1 | Protein | 1e-14 | 70 |
| unnamed | CAE85187.1 | hypothetical protein | Not tested | PAI V 536 | Protein | 8e-15 | 70 |
| S3190 | NP_838473.1 | hypothetical protein | Not tested | SHI-1 | Protein | 2e-14 | 70 |
| SF2987 | NP_708761.1 | hypothetical protein | Not tested | SHI-1 | Protein | 2e-14 | 70 |
| ECO103_3577 | YP_003223438.1 | transcriptional regulator | Not tested | LEE | Protein | 1e-14 | 70 |
| Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
| ECO111_1271 | YP_003233763.1 | putative DNA binding protein | VFG1480 | Protein | 2e-25 | 96 |
| ECO111_1271 | YP_003233763.1 | putative DNA binding protein | VFG0651 | Protein | 6e-15 | 70 |