Gene Information

Name : ECO111_1243 (ECO111_1243)
Accession : YP_003233736.1
Strain : Escherichia coli 11128
Genome accession: NC_013364
Putative virulence/resistance : Unknown
Product : hypothetical protein
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG3436
EC number : -
Position : 1293623 - 1293973 bp
Length : 351 bp
Strand : +
Note : Integrative element ECO111_IE02; predicted protein Orf2 in insertion sequence IS682

DNA sequence :
ATGATCTCGCTCCCATCAGGCACTCGAATCTGGCTGGTTGCCGGCGTTACTGATATGCGTAAATCCTTCAACGGTCTGGG
AGAACAGGTACAACATGTGCTGGATGAGAACCCCTTCTCCGGTCACCTGTTTATCTTTCGCGGCCGACGGGGTGACACGA
TTAAAATTCTGTGGGCTGATGCTGATGGTCTGTGCCTGTTCACCAAACGTCTGGAGGAAGGCCAGTTTATCTGGCCTGCG
GTGCGTGACGGTAAGGTATCCATTACCCGCTCGCAGCTGGCAATGCTCCTCGATAAACTGGACTGGCGTCAGCCCAAAAC
ATCCCGCCTTAATGCACTGACAATGTTGTAA

Protein sequence :
MISLPSGTRIWLVAGVTDMRKSFNGLGEQVQHVLDENPFSGHLFIFRGRRGDTIKILWADADGLCLFTKRLEEGQFIWPA
VRDGKVSITRSQLAMLLDKLDWRQPKTSRLNALTML

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
Z1160 NP_286695.1 hypothetical protein Not tested TAI Protein 4e-50 100
Z1599 NP_287103.1 hypothetical protein Not tested TAI Protein 4e-50 100
ECUMN_3364 YP_002414037.1 putative transposase ORF2, IS66 family Not tested Not named Protein 7e-50 98
ECO103_3567 YP_003223430.1 hypothetical protein Not tested LEE Protein 8e-49 97
Z4338 NP_289563.1 hypothetical protein Not tested OI-122 Protein 8e-49 97
aec52 AAW51735.1 Aec52 Not tested AGI-3 Protein 8e-39 70
unnamed ADD91739.1 hypothetical protein Not tested PAI-I AL862 Protein 8e-39 70
pB171ORF50 CAD66190.1 ORF50 protein of pB171 Not tested PAI III 536 Protein 2e-38 69
unnamed AAL08461.1 unknown Not tested SRL Protein 2e-35 66
unnamed AAC31493.1 L0014 Not tested LEE Protein 3e-35 65
Z5097 NP_290248.1 prophage-associated protein Not tested LEE Protein 4e-35 65
hp4 AAC61716.1 Hp4 Not tested PAI I CFT073 Protein 3e-35 65
ECs4546 NP_312573.1 hypothetical protein Not tested LEE Protein 4e-35 65
unnamed AAL99258.1 unknown Not tested LEE Protein 3e-35 65
unnamed ACU09438.1 IS66 family element orf2 Not tested LEE Protein 3e-35 65
c3561 NP_755436.1 hypothetical protein Not tested PAI I CFT073 Protein 5e-35 65
ECUMN_3327 YP_002414007.1 putative transposase ORF2, IS66 family Not tested Not named Protein 5e-35 65
c3578 NP_755453.1 hypothetical protein Not tested PAI I CFT073 Protein 4e-35 65
Z4336 NP_289561.1 hypothetical protein Not tested OI-122 Protein 4e-35 65
l0014 CAD33776.1 L0014 protein Not tested PAI I 536 Protein 1e-26 65
Z1132 NP_286667.1 hypothetical protein Not tested TAI Protein 2e-34 64
Z1571 NP_287075.1 hypothetical protein Not tested TAI Protein 2e-34 64
ECO103_3553 YP_003223420.1 hypothetical protein Not tested LEE Protein 6e-35 62
Z4316 NP_289542.1 hypothetical protein Not tested OI-122 Protein 6e-35 62
BCAM0247 YP_002232879.1 putative transposase Not tested BcenGI11 Protein 4e-28 59

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ECO111_1243 YP_003233736.1 hypothetical protein VFG1737 Protein 2e-50 98
ECO111_1243 YP_003233736.1 hypothetical protein VFG1665 Protein 9e-39 69
ECO111_1243 YP_003233736.1 hypothetical protein VFG1052 Protein 7e-36 66
ECO111_1243 YP_003233736.1 hypothetical protein VFG1709 Protein 1e-35 65
ECO111_1243 YP_003233736.1 hypothetical protein VFG0792 Protein 1e-35 65
ECO111_1243 YP_003233736.1 hypothetical protein VFG1698 Protein 1e-35 65
ECO111_1243 YP_003233736.1 hypothetical protein VFG1517 Protein 4e-27 65