Gene Information

Name : ECO26_5478 (ECO26_5478)
Accession : YP_003232346.1
Strain : Escherichia coli 11368
Genome accession: NC_013361
Putative virulence/resistance : Virulence
Product : transcriptional regulator
Function : -
COG functional category : K : Transcription
COG ID : COG3311
EC number : -
Position : 5563731 - 5563937 bp
Length : 207 bp
Strand : +
Note : Integrative element ECO26_IE09

DNA sequence :
ATGGCTACCCCTGTTTCGCTGATGGATGACCAGATGGTCGACATGGCGTTTATCACTCAACTTACCGGCTTAACCGATAA
GTGGTTTTACAAACTCATCAAAGATGGGGGCTTTCCTGCCCCCATCAAAATGGAGCGCAGCTCCCGCTGGCTGAAAAGTG
AAGTGGAAGCCTGGCTGCAGGCGCGTATTGCACAGTCCCGTCCGTAA

Protein sequence :
MATPVSLMDDQMVDMAFITQLTGLTDKWFYKLIKDGGFPAPIKMERSSRWLKSEVEAWLQARIAQSRP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ADD91712.1 putative transcriptional regulator AlpA Not tested PAI-I AL862 Protein 8e-26 96
unnamed CAI43835.1 hypothetical protein Not tested LEE Protein 8e-26 96
unnamed CAE85187.1 hypothetical protein Not tested PAI V 536 Protein 5e-26 95
ECO103_3577 YP_003223438.1 transcriptional regulator Not tested LEE Protein 1e-25 93
unnamed AAL08466.1 unknown Not tested SRL Protein 2e-25 92
S3190 NP_838473.1 hypothetical protein Not tested SHI-1 Protein 3e-25 90
SF2987 NP_708761.1 hypothetical protein Not tested SHI-1 Protein 3e-25 90
rox AAR97599.1 regulator of excision Not tested SHI-1 Protein 2e-25 90
c5192 NP_757040.1 hypothetical protein Not tested PAI II CFT073 Protein 7e-17 67
unnamed CAD33739.1 hypothetical protein Not tested PAI I 536 Protein 5e-17 67
Z1188 NP_286723.1 hypothetical protein Not tested TAI Protein 8e-14 66
Z1627 NP_287131.1 hypothetical protein Not tested TAI Protein 8e-14 66

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ECO26_5478 YP_003232346.1 transcriptional regulator VFG1057 Protein 7e-26 92
ECO26_5478 YP_003232346.1 transcriptional regulator VFG0651 Protein 8e-26 90
ECO26_5478 YP_003232346.1 transcriptional regulator VFG1480 Protein 2e-17 67