Gene Information

Name : ECO26_5452 (ECO26_5452)
Accession : YP_003232324.1
Strain : Escherichia coli 11368
Genome accession: NC_013361
Putative virulence/resistance : Unknown
Product : IS911 regulatory protein OrfA
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG2963
EC number : -
Position : 5541403 - 5541708 bp
Length : 306 bp
Strand : +
Note : Integrative element ECO26_IE09

DNA sequence :
ATGAAAAAAAGAAATTTTAGCGCAGAGTTTAAACGCGAATCCGCTCAACTGGTTGTTGACCAGACATACACGGTGGCAGA
TGCCGCCAAAGCTATGGATGTTGGCCTTTCCACAATGACAAGATGGGTCAAACAACTGCGTGATGAGCGTCAGGGCAAAA
CACCAAAAGCCTCTCCGATAACACCAGAACAAATCGAAATACGTAAGCTGAGGAAAAAGCTACAACGCATTGAAATGGAG
AATGAAATATTAAAAAAGGCTACAACCGCGCTCTTGATGTCAGACTCCCTGAACAGTTCTCGATAA

Protein sequence :
MKKRNFSAEFKRESAQLVVDQTYTVADAAKAMDVGLSTMTRWVKQLRDERQGKTPKASPITPEQIEIRKLRKKLQRIEME
NEILKKATTALLMSDSLNSSR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
l7045 CAD33744.1 - Not tested PAI I 536 Protein 3e-39 97
orfA CAE85179.1 OrfA protein, IS911 Not tested PAI V 536 Protein 3e-39 97
api80 CAF28554.1 putative transposase Not tested YAPI Protein 3e-34 94
insN YP_002152325.1 transposase for insertion sequence element IS911 Not tested Not named Protein 1e-37 93
orfA ACX47959.1 IS1359 transposase; OrfA Not tested SGI1 Protein 1e-29 75
VPI2_0009c ACA01826.1 transposase OrfAB subunit A Not tested VPI-2 Protein 1e-29 75
orfA AGK06911.1 IS1359 transposase; OrfA Not tested SGI1 Protein 1e-29 75
unnamed AGK06948.1 IS1359 transposase; OrfA Not tested SGI1 Protein 1e-29 75
orfA AGK06994.1 IS1359 transposase; OrfA Not tested SGI1 Protein 1e-29 75
orfA AGK07052.1 IS1359 transposase; OrfA Not tested SGI1 Protein 1e-29 75
VC1790 NP_231425.1 transposase OrfAB subunit A Not tested VPI-2 Protein 2e-29 75
orfA YP_001217330.1 transposase OrfAB subunit A Not tested VPI-2 Protein 2e-29 75
unnamed CAD42034.1 hypothetical protein Not tested PAI II 536 Protein 6e-28 70
unnamed ACU09431.1 IS911 transposase orfA Not tested LEE Protein 3e-24 60
ECO111_3778 YP_003236113.1 putative IS602 transposase OrfA Not tested LEE Protein 8e-23 60
aec66 AAW51749.1 Aec66 Not tested AGI-3 Protein 6e-23 60
Z5088 NP_290240.1 hypothetical protein Not tested LEE Protein 4e-24 60
ECs4535 NP_312562.1 hypothetical protein Not tested LEE Protein 4e-24 60
unnamed AAC31483.1 L0004 Not tested LEE Protein 3e-24 60
RS05 AAP82950.1 putative transposase Not tested PAPI-2 Protein 4e-21 55
tnpA CAB61575.1 transposase A Not tested HPI Protein 3e-20 47
trp1329A CAB46577.1 IS1329 transposase A Not tested HPI Protein 1e-19 46
unnamed CAD42047.1 hypothetical protein Not tested PAI II 536 Protein 1e-11 43

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ECO26_5452 YP_003232324.1 IS911 regulatory protein OrfA VFG1485 Protein 1e-39 97
ECO26_5452 YP_003232324.1 IS911 regulatory protein OrfA VFG1123 Protein 5e-30 75
ECO26_5452 YP_003232324.1 IS911 regulatory protein OrfA VFG1553 Protein 3e-28 70
ECO26_5452 YP_003232324.1 IS911 regulatory protein OrfA VFG0784 Protein 1e-24 60
ECO26_5452 YP_003232324.1 IS911 regulatory protein OrfA VFG1566 Protein 4e-12 43