Gene Information

Name : grlR (ECO26_5261)
Accession : YP_003232143.1
Strain : Escherichia coli 11368
Genome accession: NC_013361
Putative virulence/resistance : Virulence
Product : negative regulator GrlR
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 5339363 - 5339719 bp
Length : 357 bp
Strand : +
Note : Integrative element ECO26_IE08

DNA sequence :
ATGATTATGAAGGATGGCATCTATAGCATTATCTTTATTAGCAATGAAGATTCCTGTGGGGAAGGTATACTGATTAAAAA
TGGAAATTTGATCACTGGCGGAGATATTGCTTCTGTGTATCAGGGGGTCCTGTCTGAAGAGGAGGACATCATACTTCATG
TCCATCGCTATAATCATGAAATTCCCTCGGTGCTAAACATTGAACAAGATTATCAATTAGTTATCCCTAAAAAAGTACTG
AGTAATGATAGTAATGTCACATTACATTGCCATGTAAGAGGAAATGAAAAATTGTTTGTTGATGTTTATGCCAGATTTAT
AGAACCATTAATTATTAAAAACACAGAAATATCATAA

Protein sequence :
MIMKDGIYSIIFISNEDSCGEGILIKNGNLITGGDIASVYQGVLSEEEDIILHVHRYNHEIPSVLNIEQDYQLVIPKKVL
SNDSNVTLHCHVRGNEKLFVDVYARFIEPLIIKNTEIS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
st14 CAC81852.1 ST14 protein Not tested LEE II Protein 2e-50 100
unnamed AAK26705.1 unknown Not tested LEE Protein 2e-50 100
grlR YP_003232143.1 negative regulator GrlR Not tested LEE Protein 2e-50 100
unnamed AAL57532.1 unknown Not tested LEE Protein 2e-50 100
unnamed CAI43884.1 hypothetical protein Not tested LEE Protein 4e-50 99
grlR YP_003223485.1 negative regulator GrlR Not tested LEE Protein 5e-50 99
unnamed AAC38374.1 Orf10 Not tested LEE Protein 1e-47 93
grlR YP_003236098.1 negative regulator GrlR Not tested LEE Protein 2e-47 93
unnamed AAL06359.1 unknown Not tested LEE Protein 1e-45 92
unnamed AAC31523.1 L0044 Not tested LEE Protein 1e-47 92
Z5129 NP_290278.1 negative regulator GrlR Not tested LEE Protein 2e-47 92
unnamed ACU09468.1 type three secretion system protein GrlR Virulence LEE Protein 1e-47 92
ECs4578 NP_312605.1 negative regulator GrlR Not tested LEE Protein 2e-47 92
grlR AFO66405.1 putative LEE-encoded negative regulator of transcription Virulence SESS LEE Protein 2e-22 51
grlR AFO66337.1 putative LEE-encoded negative regulator of transcription Not tested SESS LEE Protein 2e-22 51

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
grlR YP_003232143.1 negative regulator GrlR VFG0720 Protein 4e-48 93
grlR YP_003232143.1 negative regulator GrlR VFG0822 Protein 5e-48 92