Gene Information

Name : Za10_0961 (Za10_0961)
Accession : YP_003226091.1
Strain : Zymomonas mobilis NCIMB 11163
Genome accession: NC_013355
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1109653 - 1110330 bp
Length : 678 bp
Strand : -
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver; KEGG: pla:Plav_0928 two component transcriptional regulator

DNA sequence :
ATGCGCGTTTTAATCGTTGAGGATGAGCCGACGCTTTCCCGTCAGTTGCGAACAACTTTGGAAGGGGCTGGCTATGCTGT
CGATCTGGCGACAGATGGCGAAGATGGTCATTTCCTAGGCTCGAGCGAAAATTATGATGCCGTCGTCCTTGATCTCGGTT
TGCCCGAAGTCGACGGTCTCACCGTTCTTGATCGTTGGCGCAAAGAAGGCCGCGAAATGCCAGTTCTGGTTCTGACTGCG
CGGGATAGCTGGTCTGATAAAGTTGCTGGTCTTGATGCTGGTGCTGATGATTATCTGACCAAGCCCTTCCAGACCGAAGA
ATTGATTGCCCGTTTGCGGGCTTTGATCCGACGGGCTTCCGGTAATGCGTCTTCTGAATTGACGGCAGGTGATGTCCGGC
TTGACACTCGTTCCGGCAAAGTGACTTTGGCGGGTGAGCCTGTCAAATTGACGGCGCAGGAATATAAGTTGCTTTCCTAT
CTGATGCATCATAAAGGCAAAGTTGTCAGTCGCACCGAAATGATCGAGCATATTTACGATCAGGATTTTGATCGTGATTC
TAATACGATTGAAGTCTTTGTAACCCGTATTCGTAAGAAACTGGGGCAGGATGTTATTACGACTATTCGCGGTTTGGGTT
ATGCTTTGAACGACCCAGAGGATCGGAATAACGGCTGA

Protein sequence :
MRVLIVEDEPTLSRQLRTTLEGAGYAVDLATDGEDGHFLGSSENYDAVVLDLGLPEVDGLTVLDRWRKEGREMPVLVLTA
RDSWSDKVAGLDAGADDYLTKPFQTEELIARLRALIRRASGNASSELTAGDVRLDTRSGKVTLAGEPVKLTAQEYKLLSY
LMHHKGKVVSRTEMIEHIYDQDFDRDSNTIEVFVTRIRKKLGQDVITTIRGLGYALNDPEDRNNG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
armR AAN62112.1 putative response-regulator ArmR Not tested PAGI-2(C) Protein 5e-29 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Za10_0961 YP_003226091.1 winged helix family two component transcriptional regulator BAC0487 Protein 4e-33 46
Za10_0961 YP_003226091.1 winged helix family two component transcriptional regulator NC_002516.2.879194.p Protein 1e-37 46
Za10_0961 YP_003226091.1 winged helix family two component transcriptional regulator CP000647.1.gene1136. Protein 2e-38 45
Za10_0961 YP_003226091.1 winged helix family two component transcriptional regulator BAC0530 Protein 2e-38 45
Za10_0961 YP_003226091.1 winged helix family two component transcriptional regulator CP004022.1.gene1005. Protein 2e-38 44
Za10_0961 YP_003226091.1 winged helix family two component transcriptional regulator NC_002695.1.913289.p Protein 1e-37 44
Za10_0961 YP_003226091.1 winged helix family two component transcriptional regulator CP000034.1.gene2022. Protein 9e-38 44
Za10_0961 YP_003226091.1 winged helix family two component transcriptional regulator CP001918.1.gene2526. Protein 4e-37 44
Za10_0961 YP_003226091.1 winged helix family two component transcriptional regulator CP001138.1.gene1939. Protein 7e-38 44
Za10_0961 YP_003226091.1 winged helix family two component transcriptional regulator BAC0308 Protein 1e-28 42
Za10_0961 YP_003226091.1 winged helix family two component transcriptional regulator BAC0197 Protein 2e-31 42
Za10_0961 YP_003226091.1 winged helix family two component transcriptional regulator BAC0083 Protein 4e-29 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Za10_0961 YP_003226091.1 winged helix family two component transcriptional regulator VFG0473 Protein 2e-31 45
Za10_0961 YP_003226091.1 winged helix family two component transcriptional regulator VFG0475 Protein 7e-38 44
Za10_0961 YP_003226091.1 winged helix family two component transcriptional regulator VFG1390 Protein 3e-29 42