Gene Information

Name : ECO103_3769 (ECO103_3769)
Accession : YP_003223620.1
Strain : Escherichia coli 12009
Genome accession: NC_013353
Putative virulence/resistance : Resistance
Product : tellurium resistance protein TerD
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG2310
EC number : -
Position : 3843829 - 3844407 bp
Length : 579 bp
Strand : -
Note : Integrative element ECO103_IE04

DNA sequence :
ATGAGTGTTTCTCTTTCCAAAGGCGGGAACGTCTCCCTGAGTAAAGCAGCTCCGTCAATGAAAAATGTCCTGGTGGGCCT
TGGCTGGGATGCGCGTTCAACAGACGGTCAGGACTTTGACCTGGATGCTTCAGCATTCCTGCTGGCCTCAAACGGCAAAG
TGCGCGGCGATTCAGATTTCATCTTCTATAACAACCTGACGTCATCCGACGGTTCCGTAACGCACACCGGCGATAACCGC
ACCGGTGAGGGCGATGGTGATGATGAATCGCTGAAAATTAAACTGGACGCCGTCCCGTCTGAAGTTGACAAGATCATCTT
CGTTGTGACCATCCACGATGCTCAGGCTCGTCGCCAGAGCTTTGGTCAGGTATCCGGTGCGTTTATTCGTCTGGTTAATG
ACGATAACCAGACTGAAGTCGCTCGCTACGATCTGACCGAAGATGCGTCCACTGAGACTGCCATGCTGTTCGGCGAGCTG
TATCGCCACAATGGTGAGTGGAAATTCCGCGCAGTAGGCCAGGGTTATGCTGGTGGTCTGGCATCTGTATGTGCTCAGTA
CGGCATTAACGCGTCCTGA

Protein sequence :
MSVSLSKGGNVSLSKAAPSMKNVLVGLGWDARSTDGQDFDLDASAFLLASNGKVRGDSDFIFYNNLTSSDGSVTHTGDNR
TGEGDGDDESLKIKLDAVPSEVDKIIFVVTIHDAQARRQSFGQVSGAFIRLVNDDNQTEVARYDLTEDASTETAMLFGEL
YRHNGEWKFRAVGQGYAGGLASVCAQYGINAS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-83 100
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-83 100
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 2e-83 99
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 1e-66 69
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 1e-59 65
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-59 65
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-59 65
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 8e-59 63
terZ NP_286706.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 7e-24 41
terZ_2 NP_287114.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 7e-24 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ECO103_3769 YP_003223620.1 tellurium resistance protein TerD BAC0389 Protein 4e-82 96
ECO103_3769 YP_003223620.1 tellurium resistance protein TerD BAC0390 Protein 6e-64 68