Gene Information

Name : ECO103_3752 (ECO103_3752)
Accession : YP_003223604.1
Strain : Escherichia coli 12009
Genome accession: NC_013353
Putative virulence/resistance : Virulence
Product : hypothetical protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 3828918 - 3829286 bp
Length : 369 bp
Strand : -
Note : Integrative element ECO103_IE04

DNA sequence :
GTGTCAGACACACTCCATGAGACAAATTATCCCAACGACAATCACAACCGCCCCTGGTGGGGACTGCCCTGCACCGTGAC
GCCCTGTTTCGGGGCACGTCTGGTGCAGGAGGGTAACCGGTTGCATTACCTTGACGACCGCGCCGGTATCAGAGGCCGGT
TCAGCGACGCGGATGCGTACCACCTGGACCAGGCCTTTCCGCTGCTGATGAAACAACTGGAACTCATGCTCACCAGCGGT
GAACTGAATCCCCGCCATCAGCATACCGTGGCACTGTATGCGAAAGGGCTGACCTGCGATGCCGACACCCTCGGCTCCTG
TGGTTACGTTTATCTGGCTGTTTATCCGACGCCCGATATGAAAAAGTAA

Protein sequence :
MSDTLHETNYPNDNHNRPWWGLPCTVTPCFGARLVQEGNRLHYLDDRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVALYAKGLTCDADTLGSCGYVYLAVYPTPDMKK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
ECO103_3591 YP_003223448.1 hypothetical protein Not tested LEE Protein 1e-49 92
yeeU YP_853121.1 antitoxin of the YeeV-YeeU toxin-antitoxin system Virulence PAI IV APEC-O1 Protein 9e-50 90
yeeU NP_838486.1 structural protein Not tested SHI-1 Protein 2e-49 90
yeeU NP_708772.1 structural protein Not tested SHI-1 Protein 2e-49 90
unnamed AAK00481.1 unknown Not tested SHI-1 Protein 3e-49 90
yeeU YP_854324.1 hypothetical protein Not tested PAI I APEC-O1 Protein 8e-50 90
yeeU AAZ04460.1 conserved hypothetical protein Not tested PAI I APEC-O1 Protein 6e-50 90
unnamed AAL67343.1 intergenic-region protein Not tested PAI II CFT073 Protein 8e-50 90
yeeU CAD42100.1 hypothetical protein Not tested PAI II 536 Protein 5e-50 89
aec75 AAW51758.1 Aec75 Not tested AGI-3 Protein 2e-50 89
unnamed CAD66206.1 hypothetical protein Not tested PAI III 536 Protein 2e-48 89
c5150 NP_756998.1 hypothetical protein Not tested PAI II CFT073 Protein 8e-50 89
Z1220 NP_286755.1 structural protein Not tested TAI Protein 2e-47 88
Z1658 NP_287161.1 structural protein Not tested TAI Protein 2e-47 88
yeeU CAE85203.1 YeeU protein Not tested PAI V 536 Protein 2e-49 88
yeeU ADD91700.1 YeeU Not tested PAI-I AL862 Protein 4e-49 87
unnamed CAI43903.1 hypothetical protein Not tested LEE Protein 5e-48 86
unnamed AAL08477.1 unknown Not tested SRL Protein 5e-47 85
unnamed AAL57576.1 unknown Not tested LEE Protein 1e-47 84

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ECO103_3752 YP_003223604.1 hypothetical protein VFG0662 Protein 6e-50 90
ECO103_3752 YP_003223604.1 hypothetical protein VFG1681 Protein 8e-49 89
ECO103_3752 YP_003223604.1 hypothetical protein VFG1619 Protein 2e-50 89
ECO103_3752 YP_003223604.1 hypothetical protein VFG1068 Protein 2e-47 85