Gene Information

Name : grlR (ECO103_3628)
Accession : YP_003223485.1
Strain : Escherichia coli 12009
Genome accession: NC_013353
Putative virulence/resistance : Virulence
Product : negative regulator GrlR
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 3704162 - 3704518 bp
Length : 357 bp
Strand : -
Note : Integrative element ECO103_IE03

DNA sequence :
ATGATTATGAAGGATGGCATCTATAGCATTATCTTTATTAGCAATGAAGATTCCTGTGGGGAAGGTATACTGATTAAAAA
TGGAAATTTGATCACTGGCGGAGATATTGCTTCTGTGTATCAGGGGGTCCTGTCTGAAGAGGAGGACATCATACTTCATG
TCCATCGCTATAATCATGAAATTCCCTCGGTGCTAAACATTGAACAAGATTATCAATTAGTTATCCCTAAAAAAGTACTG
AGTAATGATAGTAATGTCACATTACATTGCCATGTAAGAGGAAATGAAAAATTGTTTGTTGATGTTTATGCCAGATTTAT
AGAACCATTAACTATTAAAAATACAGAAATATCATAA

Protein sequence :
MIMKDGIYSIIFISNEDSCGEGILIKNGNLITGGDIASVYQGVLSEEEDIILHVHRYNHEIPSVLNIEQDYQLVIPKKVL
SNDSNVTLHCHVRGNEKLFVDVYARFIEPLTIKNTEIS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
grlR YP_003223485.1 negative regulator GrlR Not tested LEE Protein 2e-50 100
unnamed CAI43884.1 hypothetical protein Not tested LEE Protein 1e-50 100
unnamed AAL57532.1 unknown Not tested LEE Protein 4e-50 99
st14 CAC81852.1 ST14 protein Not tested LEE II Protein 4e-50 99
unnamed AAK26705.1 unknown Not tested LEE Protein 4e-50 99
grlR YP_003232143.1 negative regulator GrlR Not tested LEE Protein 5e-50 99
unnamed AAL06359.1 unknown Not tested LEE Protein 3e-45 92
unnamed AAC38374.1 Orf10 Not tested LEE Protein 2e-47 92
grlR YP_003236098.1 negative regulator GrlR Not tested LEE Protein 3e-47 92
unnamed AAC31523.1 L0044 Not tested LEE Protein 2e-47 92
Z5129 NP_290278.1 negative regulator GrlR Not tested LEE Protein 3e-47 92
unnamed ACU09468.1 type three secretion system protein GrlR Virulence LEE Protein 2e-47 92
ECs4578 NP_312605.1 negative regulator GrlR Not tested LEE Protein 3e-47 92
grlR AFO66337.1 putative LEE-encoded negative regulator of transcription Not tested SESS LEE Protein 7e-23 51
grlR AFO66405.1 putative LEE-encoded negative regulator of transcription Virulence SESS LEE Protein 7e-23 51

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
grlR YP_003223485.1 negative regulator GrlR VFG0822 Protein 8e-48 92
grlR YP_003223485.1 negative regulator GrlR VFG0720 Protein 1e-47 92