Gene Information

Name : ECO103_3591 (ECO103_3591)
Accession : YP_003223448.1
Strain : Escherichia coli 12009
Genome accession: NC_013353
Putative virulence/resistance : Virulence
Product : hypothetical protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 3671928 - 3672302 bp
Length : 375 bp
Strand : +
Note : Integrative element ECO103_IE03

DNA sequence :
GTGTCAGGCACACTCCATGAGACAAATTATCCCAACGACAACAACGACCGCCCCTGGTGGGGGCTCCCCTGCACCGTGAC
GCCCTGTTTCGGGGCACGTCTGGTGCAGGAGGGCAATCAATTACATTACCTTGCCGACCGCGCCGGTATCAGGGGGCAGT
TTAGCGACGCGGATGCGTATCATCTGGACCAGGCCTTTCCGCTGCTGATGAAACAACTGGAACTCATGCTCACCAGCGGT
GAACTGAATCCCCGCCATCAGCATACCGTCACGCTGTATGCCAGAGGGCTGACCTGCGAAGCCGACACCCTCGGCAGCTG
TGGTTACGTTTATATGGCTGTTTATCCGACACTGGCACCCGCAACCACCTCATAA

Protein sequence :
MSGTLHETNYPNDNNDRPWWGLPCTVTPCFGARLVQEGNQLHYLADRAGIRGQFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYARGLTCEADTLGSCGYVYMAVYPTLAPATTS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
ECO103_3591 YP_003223448.1 hypothetical protein Not tested LEE Protein 3e-54 100
unnamed AAL67343.1 intergenic-region protein Not tested PAI II CFT073 Protein 1e-53 97
yeeU CAD42100.1 hypothetical protein Not tested PAI II 536 Protein 4e-48 92
yeeU ADD91700.1 YeeU Not tested PAI-I AL862 Protein 2e-47 90
aec75 AAW51758.1 Aec75 Not tested AGI-3 Protein 2e-47 89
yeeU YP_853121.1 antitoxin of the YeeV-YeeU toxin-antitoxin system Virulence PAI IV APEC-O1 Protein 6e-47 89
unnamed CAD66206.1 hypothetical protein Not tested PAI III 536 Protein 6e-46 89
c5150 NP_756998.1 hypothetical protein Not tested PAI II CFT073 Protein 1e-46 89
yeeU CAE85203.1 YeeU protein Not tested PAI V 536 Protein 9e-47 89
Z1220 NP_286755.1 structural protein Not tested TAI Protein 5e-47 87
Z1658 NP_287161.1 structural protein Not tested TAI Protein 5e-47 87
yeeU NP_708772.1 structural protein Not tested SHI-1 Protein 4e-48 86
yeeU NP_838486.1 structural protein Not tested SHI-1 Protein 4e-48 86
unnamed CAI43903.1 hypothetical protein Not tested LEE Protein 4e-45 86
unnamed AAK00481.1 unknown Not tested SHI-1 Protein 6e-48 85
yeeU YP_854324.1 hypothetical protein Not tested PAI I APEC-O1 Protein 2e-48 85
yeeU AAZ04460.1 conserved hypothetical protein Not tested PAI I APEC-O1 Protein 1e-48 85
unnamed AAL08477.1 unknown Not tested SRL Protein 1e-46 84
unnamed AAL57576.1 unknown Not tested LEE Protein 8e-45 84

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ECO103_3591 YP_003223448.1 hypothetical protein VFG1619 Protein 2e-48 92
ECO103_3591 YP_003223448.1 hypothetical protein VFG1681 Protein 3e-46 89
ECO103_3591 YP_003223448.1 hypothetical protein VFG0662 Protein 1e-48 86
ECO103_3591 YP_003223448.1 hypothetical protein VFG1068 Protein 6e-47 84