Gene Information

Name : CDR20291_2526 (CDR20291_2526)
Accession : YP_003219006.1
Strain : Clostridium difficile R20291
Genome accession: NC_013316
Putative virulence/resistance : Virulence
Product : two-component response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2963027 - 2963719 bp
Length : 693 bp
Strand : -
Note : -

DNA sequence :
ATGAATACTAAAGTGCTTGTTATAGACGATGAAATGCATATAGTTGAGCTATTAAAATTCAATTTGGAGGTGTCAAATTA
CGAAGTTAGTTATTCATATGATGGATTTGACGGATTTATAAAGGCTAAGGAAATTAAACCAGATTTAATACTTTTAGATT
GGATGTTACCAAATATAAGTGGAATAGAAGTTTTGAGAAAAATAAGAAGTGATAAGGACTTAAAAAATATTCCTGTTATA
ATGCTTACTGCTAAAAATATGGAAAATGACAAGGTTGAAGGGCTTGAAATAGGTGCTGATGACTATATAACTAAGCCATT
TAGTATAAAAGAGTTGTTAGCTAGGATTAGTTCTGTTTTAAGGAGATATAATTTGACTAGCTTAGGTGAAGAAAACAATA
TACTTACTACAGGCAATTTAAAACTAGATTTATCAAAACATGAAGTTACCAAAGGCTCTGAAAAGATAGAGTTAACTCTT
AAGGAATTTGAATTGTTAAAATTATTAATTCAAAATAAAGGAAAAGTACTTTCAAGAAATTATCTTTTGGATAAAATATG
GGGGTATGAATACTATGGAGAAACTAGAACAGTAGATGTTCATATAAGATATTTAAGAAAAAAAATAGAAGATGAAGATA
AATCGGAAAAATATATAGAGACTATAAGAGGTGTAGGGTATAAAATAGATTAA

Protein sequence :
MNTKVLVIDDEMHIVELLKFNLEVSNYEVSYSYDGFDGFIKAKEIKPDLILLDWMLPNISGIEVLRKIRSDKDLKNIPVI
MLTAKNMENDKVEGLEIGADDYITKPFSIKELLARISSVLRRYNLTSLGEENNILTTGNLKLDLSKHEVTKGSEKIELTL
KEFELLKLLIQNKGKVLSRNYLLDKIWGYEYYGETRTVDVHIRYLRKKIEDEDKSEKYIETIRGVGYKID

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
vanRB YP_001698483.1 regulatory protein Not tested Not named Protein 6e-23 43
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-26 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
CDR20291_2526 YP_003219006.1 two-component response regulator HE999704.1.gene2815. Protein 2e-40 51
CDR20291_2526 YP_003219006.1 two-component response regulator NC_002952.2859905.p0 Protein 4e-42 49
CDR20291_2526 YP_003219006.1 two-component response regulator NC_009782.5559369.p0 Protein 5e-42 49
CDR20291_2526 YP_003219006.1 two-component response regulator NC_002951.3237708.p0 Protein 5e-42 49
CDR20291_2526 YP_003219006.1 two-component response regulator NC_003923.1003749.p0 Protein 5e-42 49
CDR20291_2526 YP_003219006.1 two-component response regulator NC_002758.1121668.p0 Protein 5e-42 49
CDR20291_2526 YP_003219006.1 two-component response regulator NC_007622.3794472.p0 Protein 4e-42 49
CDR20291_2526 YP_003219006.1 two-component response regulator NC_009641.5332272.p0 Protein 5e-42 49
CDR20291_2526 YP_003219006.1 two-component response regulator NC_013450.8614421.p0 Protein 5e-42 49
CDR20291_2526 YP_003219006.1 two-component response regulator NC_007793.3914279.p0 Protein 5e-42 49
CDR20291_2526 YP_003219006.1 two-component response regulator NC_002745.1124361.p0 Protein 5e-42 49
CDR20291_2526 YP_003219006.1 two-component response regulator NC_010079.5776364.p0 Protein 2e-31 46
CDR20291_2526 YP_003219006.1 two-component response regulator NC_002952.2859858.p0 Protein 2e-31 46
CDR20291_2526 YP_003219006.1 two-component response regulator NC_007622.3794948.p0 Protein 2e-31 46
CDR20291_2526 YP_003219006.1 two-component response regulator NC_003923.1003417.p0 Protein 2e-31 46
CDR20291_2526 YP_003219006.1 two-component response regulator NC_013450.8614146.p0 Protein 2e-31 46
CDR20291_2526 YP_003219006.1 two-component response regulator NC_002951.3238224.p0 Protein 2e-31 46
CDR20291_2526 YP_003219006.1 two-component response regulator NC_007793.3914065.p0 Protein 2e-31 46
CDR20291_2526 YP_003219006.1 two-component response regulator NC_002758.1121390.p0 Protein 2e-31 46
CDR20291_2526 YP_003219006.1 two-component response regulator AE016830.1.gene1681. Protein 4e-35 46
CDR20291_2526 YP_003219006.1 two-component response regulator NC_012469.1.7686381. Protein 2e-33 45
CDR20291_2526 YP_003219006.1 two-component response regulator AE015929.1.gene1106. Protein 3e-25 44
CDR20291_2526 YP_003219006.1 two-component response regulator HE999704.1.gene1528. Protein 9e-28 44
CDR20291_2526 YP_003219006.1 two-component response regulator NC_012469.1.7685629. Protein 1e-36 43
CDR20291_2526 YP_003219006.1 two-component response regulator NC_005054.2598277.p0 Protein 3e-32 42
CDR20291_2526 YP_003219006.1 two-component response regulator BAC0125 Protein 1e-25 42
CDR20291_2526 YP_003219006.1 two-component response regulator NC_014475.1.orf0.gen Protein 3e-32 42
CDR20291_2526 YP_003219006.1 two-component response regulator AF155139.2.orf0.gene Protein 2e-28 42
CDR20291_2526 YP_003219006.1 two-component response regulator AE000516.2.gene3505. Protein 4e-32 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
CDR20291_2526 YP_003219006.1 two-component response regulator VFG0596 Protein 5e-27 41