Gene Information

Name : CD196_1978 (CD196_1978)
Accession : YP_003214999.1
Strain : Clostridium difficile CD196
Genome accession: NC_013315
Putative virulence/resistance : Resistance
Product : two-component system response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2283512 - 2284180 bp
Length : 669 bp
Strand : -
Note : -

DNA sequence :
ATGAATTCGTCAATACTTGTAATTGAAGATGATTCAAATATACAAGAGTTAATATCAGAATTTTTAAGTGCAGAAGGTTA
TCAAGTTGATACAGCAAATGATGGGTTGGAAGGTATACAAAAGTTTAAGCAAGGAAGTTATGATTTAGTAATATTAGATA
TAATGATGCCAAACTTAGATGGTTATGGAGTTTGTAAAATGATAAGAAAGTCATCAAGCGTTCCAATTATATTTTTAACT
GCTTTAAATGATGAAGGAGACCAACTTAAAGGGTTTGACTTAGAATGTGATGATTATATAACAAAACCATTTTCATTTAA
TCTTCTTATAAAAAGAGTAGAAGCAATTTTAAGGCGAAGTAACAAGACTATAAATGACAAATTTATAGTTTTTGAAAAAT
TAAAATTAGATTTAAACACATATATTGCAGAGATAGATGGAGAACCTATAGAACTTACACTAAAAGAGTTTAATATATTA
AAAGCTTTGATAGAAAAGTATCCACAAGTTATAACTAGGGAAGGTCTTTTGGATAGTATATGGGGTTATGACTATTATGG
AGATACTAGGATTGTTGATGCACATATAAAAAATATAAGAAAAAAAATATCGTTACCATATATTAAAACTGTAAAAGGAA
TAGGATATACACTTGAGAAGGATATTTGA

Protein sequence :
MNSSILVIEDDSNIQELISEFLSAEGYQVDTANDGLEGIQKFKQGSYDLVILDIMMPNLDGYGVCKMIRKSSSVPIIFLT
ALNDEGDQLKGFDLECDDYITKPFSFNLLIKRVEAILRRSNKTINDKFIVFEKLKLDLNTYIAEIDGEPIELTLKEFNIL
KALIEKYPQVITREGLLDSIWGYDYYGDTRIVDAHIKNIRKKISLPYIKTVKGIGYTLEKDI

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
vanRB YP_001698483.1 regulatory protein Not tested Not named Protein 9e-50 49
vanRB YP_008394254.1 DNA-binding response regulator VanRB Not tested Not named Protein 1e-42 44
vanRB NP_815956.1 DNA-binding response regulator VanRB Not tested Not named Protein 8e-42 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
CD196_1978 YP_003214999.1 two-component system response regulator HE999704.1.gene1202. Protein 4e-47 47
CD196_1978 YP_003214999.1 two-component system response regulator AF310956.2.orf0.gene Protein 5e-43 44
CD196_1978 YP_003214999.1 two-component system response regulator U35369.1.gene1.p01 Protein 3e-42 43
CD196_1978 YP_003214999.1 two-component system response regulator AE016830.1.gene2255. Protein 3e-42 43
CD196_1978 YP_003214999.1 two-component system response regulator NC_002952.2859905.p0 Protein 7e-36 43
CD196_1978 YP_003214999.1 two-component system response regulator NC_003923.1003749.p0 Protein 9e-36 43
CD196_1978 YP_003214999.1 two-component system response regulator NC_002758.1121668.p0 Protein 9e-36 43
CD196_1978 YP_003214999.1 two-component system response regulator NC_009641.5332272.p0 Protein 9e-36 43
CD196_1978 YP_003214999.1 two-component system response regulator NC_013450.8614421.p0 Protein 9e-36 43
CD196_1978 YP_003214999.1 two-component system response regulator NC_007793.3914279.p0 Protein 9e-36 43
CD196_1978 YP_003214999.1 two-component system response regulator NC_007622.3794472.p0 Protein 7e-36 43
CD196_1978 YP_003214999.1 two-component system response regulator NC_002745.1124361.p0 Protein 9e-36 43
CD196_1978 YP_003214999.1 two-component system response regulator NC_009782.5559369.p0 Protein 9e-36 43
CD196_1978 YP_003214999.1 two-component system response regulator NC_002951.3237708.p0 Protein 9e-36 43
CD196_1978 YP_003214999.1 two-component system response regulator NC_012469.1.7685629. Protein 1e-36 42