Gene Information

Name : ramA (CTU_29250)
Accession : YP_003211288.1
Strain : Cronobacter turicensis z3032
Genome accession: NC_013282
Putative virulence/resistance : Resistance
Product : transcriptional activator ramA
Function : -
COG functional category : K : Transcription
COG ID : COG2207
EC number : -
Position : 3060210 - 3060554 bp
Length : 345 bp
Strand : -
Note : -

DNA sequence :
ATGGAACTTCCCGCTCAGGTTATTGAAACGCTGACTGACTGGATTGATGACAATCTTCACAAGCCGTTGCGCATTGATGA
TATTGCGCGCCACGCGGGCTATTCCAAATGGCATTTGCAACGGCTTTTCCATCACCACAAAGGGGAGAGCATCGGGCGCT
ACATCCGGGAGAAAAAGCTGCGTCTGGCGGCGCAGGATCTGCGCGCTACTAACGATCGCGTGCTGGATATCTCAATGAAA
TATGGGTTTGACTCCCAGCAAACTTTTACGCGCCTGTTCACGCGTAAATTTCAGATGTCGCCGGGCACGTGGCGCAAGCA
GGGCGACGCGCCGACGAACCACTGA

Protein sequence :
MELPAQVIETLTDWIDDNLHKPLRIDDIARHAGYSKWHLQRLFHHHKGESIGRYIREKKLRLAAQDLRATNDRVLDISMK
YGFDSQQTFTRLFTRKFQMSPGTWRKQGDAPTNH

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
soxS YP_219131.1 DNA-binding transcriptional regulator SoxS Not tested SPI-4 Protein 4e-23 47
tetD AAL08447.1 putative transcriptional regulator TetD Not tested SRL Protein 4e-20 43
tetD AEA34665.1 tetracycline resistance protein D Not tested Not named Protein 4e-20 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ramA YP_003211288.1 transcriptional activator ramA CP001138.1.gene612.p Protein 1e-37 68
ramA YP_003211288.1 transcriptional activator ramA CP001918.1.gene327.p Protein 3e-24 49
ramA YP_003211288.1 transcriptional activator ramA CP000647.1.gene4499. Protein 4e-24 47
ramA YP_003211288.1 transcriptional activator ramA CP001138.1.gene4488. Protein 1e-23 47
ramA YP_003211288.1 transcriptional activator ramA CP001918.1.gene2033. Protein 9e-22 46
ramA YP_003211288.1 transcriptional activator ramA BAC0371 Protein 1e-22 45
ramA YP_003211288.1 transcriptional activator ramA NC_002695.1.914293.p Protein 1e-22 45
ramA YP_003211288.1 transcriptional activator ramA CP000647.1.gene1624. Protein 2e-21 45
ramA YP_003211288.1 transcriptional activator ramA CP001138.1.gene1637. Protein 1e-21 45
ramA YP_003211288.1 transcriptional activator ramA BAC0560 Protein 1e-21 45
ramA YP_003211288.1 transcriptional activator ramA NC_002695.1.917339.p Protein 1e-21 45
ramA YP_003211288.1 transcriptional activator ramA CP000034.1.gene1596. Protein 1e-21 45
ramA YP_003211288.1 transcriptional activator ramA CP000034.1.gene4505. Protein 2e-22 44
ramA YP_003211288.1 transcriptional activator ramA NC_010558.1.6276025. Protein 2e-20 43

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ramA YP_003211288.1 transcriptional activator ramA VFG0585 Protein 1e-23 47
ramA YP_003211288.1 transcriptional activator ramA VFG1038 Protein 2e-20 43