Gene Information

Name : Namu_4670 (Namu_4670)
Accession : YP_003203936.1
Strain : Nakamurella multipartita DSM 44233
Genome accession: NC_013235
Putative virulence/resistance : Resistance
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 5189925 - 5190632 bp
Length : 708 bp
Strand : +
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver; KEGG: reu:Reut_A1815 two component heavy metal response transcriptional regulator

DNA sequence :
GTGAATGCTGCCGGTGTCCGCATCCTGGTCGTCGAGGACGACGATCTGCTGCGTGCGGTGATCGCGGAGTCGTTGCGCGA
CGCCGGCCACCTGGTGGAGGTCAGCGCGGACGGGATGGCCGCGGCGGCCGTCGCGGACAGCTTCCGGCCGGACCTGGCCG
TGCTGGACGTGATGCTCCCCCACTGGTCCGGCCTCGAGCTGGCCCGGGCGCTGCGCGGTGGCACCGACGTCCCGGTGATC
TTCGTGACCGCGTTGGACGGCGTCGACGACCGGCTGGCCGGGTTCGACGCCGGAGCCGATGACTACCTGGTCAAGCCGTT
CGCGGTGGCCGAGCTGTTGGCCCGGGTCAGCGCGGTGCTGCGCCGGTCCGGCCGGCTCTCGGCCCAGTTGATCGAGGTCG
GCGACCTCATCGTCGACGACGACGCCGGGGTGGTGCAGCGTGCGGGTCAGGAGATCGACCTGACCGCGACGGAACGACGC
CTGCTGCTCTACCTGGCCCGGCACCGCGGCCGGGTGCTCTCGAAAACCCAGATTCTGACGCAGGTCTGGGGATACGACGC
CTACGACCCGAACCTGGTCGAGGCCTTCATCTCCGGGCTGCGGCGCAAGCTCGACCAGCACGGGCCTCGGCTGATCCACA
CCGTCCGAGGCGTGGGCTACCGGCTCGCCGCGCCCGTGCCCGCCGCCGCGGCCGACCGCGATGACTGA

Protein sequence :
MNAAGVRILVVEDDDLLRAVIAESLRDAGHLVEVSADGMAAAAVADSFRPDLAVLDVMLPHWSGLELARALRGGTDVPVI
FVTALDGVDDRLAGFDAGADDYLVKPFAVAELLARVSAVLRRSGRLSAQLIEVGDLIVDDDAGVVQRAGQEIDLTATERR
LLLYLARHRGRVLSKTQILTQVWGYDAYDPNLVEAFISGLRRKLDQHGPRLIHTVRGVGYRLAAPVPAAAADRDD

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
vanRB YP_008394254.1 DNA-binding response regulator VanRB Not tested Not named Protein 2e-29 41
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-25 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Namu_4670 YP_003203936.1 winged helix family two component transcriptional regulator BAC0083 Protein 2e-29 46
Namu_4670 YP_003203936.1 winged helix family two component transcriptional regulator BAC0638 Protein 1e-22 45
Namu_4670 YP_003203936.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 3e-31 45
Namu_4670 YP_003203936.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 3e-31 45
Namu_4670 YP_003203936.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 3e-31 45
Namu_4670 YP_003203936.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 3e-31 45
Namu_4670 YP_003203936.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 3e-31 45
Namu_4670 YP_003203936.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 3e-31 45
Namu_4670 YP_003203936.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 3e-31 45
Namu_4670 YP_003203936.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 3e-31 45
Namu_4670 YP_003203936.1 winged helix family two component transcriptional regulator BAC0197 Protein 4e-25 45
Namu_4670 YP_003203936.1 winged helix family two component transcriptional regulator BAC0125 Protein 1e-30 44
Namu_4670 YP_003203936.1 winged helix family two component transcriptional regulator AE015929.1.gene1106. Protein 2e-27 43
Namu_4670 YP_003203936.1 winged helix family two component transcriptional regulator HE999704.1.gene1528. Protein 1e-22 42
Namu_4670 YP_003203936.1 winged helix family two component transcriptional regulator AF310956.2.orf0.gene Protein 1e-29 41
Namu_4670 YP_003203936.1 winged helix family two component transcriptional regulator BAC0347 Protein 2e-27 41
Namu_4670 YP_003203936.1 winged helix family two component transcriptional regulator BAC0111 Protein 2e-29 41
Namu_4670 YP_003203936.1 winged helix family two component transcriptional regulator NC_002516.2.879194.p Protein 2e-27 41
Namu_4670 YP_003203936.1 winged helix family two component transcriptional regulator BAC0288 Protein 6e-22 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Namu_4670 YP_003203936.1 winged helix family two component transcriptional regulator VFG1389 Protein 7e-32 53
Namu_4670 YP_003203936.1 winged helix family two component transcriptional regulator VFG1390 Protein 2e-32 48
Namu_4670 YP_003203936.1 winged helix family two component transcriptional regulator VFG0596 Protein 7e-26 41
Namu_4670 YP_003203936.1 winged helix family two component transcriptional regulator VFG1386 Protein 4e-31 41