Gene Information

Name : Dret_0467 (Dret_0467)
Accession : YP_003197342.1
Strain : Desulfohalobium retbaense DSM 5692
Genome accession: NC_013223
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator, winged helix family
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 572368 - 573060 bp
Length : 693 bp
Strand : +
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver; KEGG: sfu:Sfum_0707 two component transcriptional regulator, winged helix family

DNA sequence :
ATGACCACCTATACTGTGCTCCTCGTGGAAGACGAGGTGGATATCCTGAATCTGTTGCGCATCAATTTTGAAAACGGCGG
TTTTCGAGTTTTGACTGCGGAAAATGGGTTCCAGGCCCTGGATGTTTTGAGCAGCGCACCAGTTGACCTGGTCGTCCTGG
ATCTGATGCTGCCCGGCAAGGATGGCTTGGAAGTCTGCCGTGAATTGCGTTCCCGGGAGTCCACGAAACATTTACCGGTG
ATCATGCTCACAGCCAAAGGCGACGAGGTCGACCGCATCGTTGGACTGGAACTCGGCGCTGACGACTATGTGGTGAAGCC
ATTTAGTCCCCGGGAGCTTTTGCTCCGGGCCAAGGCGGTCATGCGTCGCGGCAAACCGCAGCCGGAAGAAGAAACCCTAT
GGGAGTCGGGAGGGTTGCGCGTCGATTTCGGGACCTACAAAGTGACCGTCGACGGCGAAGACCGGGAATTGACAGCCACC
GAATTTCGGCTTTTGGTCCATCTCATCCGCAGTCGGGGCAAGGTCCAGACCCGTGATCAATTGTTGAACAAGGTTTGGGG
GTATGAATTCGAAGGCTATGCCCGAACCGTGGATACCCATGTCCGCCGCTTGCGGCACAAGATTGAACCGTATGCTGCCA
TTGTCGAGACCGTCCGCGGGGTGGGCTACCGCCTCCACGGTCAGGAGGAGTGA

Protein sequence :
MTTYTVLLVEDEVDILNLLRINFENGGFRVLTAENGFQALDVLSSAPVDLVVLDLMLPGKDGLEVCRELRSRESTKHLPV
IMLTAKGDEVDRIVGLELGADDYVVKPFSPRELLLRAKAVMRRGKPQPEEETLWESGGLRVDFGTYKVTVDGEDRELTAT
EFRLLVHLIRSRGKVQTRDQLLNKVWGYEFEGYARTVDTHVRRLRHKIEPYAAIVETVRGVGYRLHGQEE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 1e-34 42
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 2e-34 42
mprA YP_005684640.1 response regulator mprA Not tested PiCp 3 Protein 2e-24 41
mprA YP_005680459.1 response regulator mprA Not tested PiCp 3 Protein 2e-24 41
mprA YP_005682550.1 response regulator mprA Not tested PiCp 3 Protein 2e-24 41
tcsR1 YP_003782583.1 two-component system transcriptional regulatory protein Not tested PiCp 3 Protein 2e-24 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Dret_0467 YP_003197342.1 two component transcriptional regulator, winged helix family AE016830.1.gene1681. Protein 8e-41 46
Dret_0467 YP_003197342.1 two component transcriptional regulator, winged helix family NC_009641.5332272.p0 Protein 8e-41 46
Dret_0467 YP_003197342.1 two component transcriptional regulator, winged helix family NC_013450.8614421.p0 Protein 8e-41 46
Dret_0467 YP_003197342.1 two component transcriptional regulator, winged helix family NC_007793.3914279.p0 Protein 8e-41 46
Dret_0467 YP_003197342.1 two component transcriptional regulator, winged helix family NC_002745.1124361.p0 Protein 8e-41 46
Dret_0467 YP_003197342.1 two component transcriptional regulator, winged helix family NC_009782.5559369.p0 Protein 8e-41 46
Dret_0467 YP_003197342.1 two component transcriptional regulator, winged helix family NC_002951.3237708.p0 Protein 8e-41 46
Dret_0467 YP_003197342.1 two component transcriptional regulator, winged helix family NC_003923.1003749.p0 Protein 9e-41 46
Dret_0467 YP_003197342.1 two component transcriptional regulator, winged helix family NC_002758.1121668.p0 Protein 8e-41 46
Dret_0467 YP_003197342.1 two component transcriptional regulator, winged helix family HE999704.1.gene2815. Protein 3e-39 46
Dret_0467 YP_003197342.1 two component transcriptional regulator, winged helix family NC_002952.2859905.p0 Protein 1e-40 45
Dret_0467 YP_003197342.1 two component transcriptional regulator, winged helix family NC_007622.3794472.p0 Protein 1e-40 45
Dret_0467 YP_003197342.1 two component transcriptional regulator, winged helix family AE000516.2.gene3505. Protein 8e-34 45
Dret_0467 YP_003197342.1 two component transcriptional regulator, winged helix family NC_003923.1003417.p0 Protein 5e-36 44
Dret_0467 YP_003197342.1 two component transcriptional regulator, winged helix family NC_013450.8614146.p0 Protein 5e-36 44
Dret_0467 YP_003197342.1 two component transcriptional regulator, winged helix family NC_002951.3238224.p0 Protein 5e-36 44
Dret_0467 YP_003197342.1 two component transcriptional regulator, winged helix family NC_007793.3914065.p0 Protein 5e-36 44
Dret_0467 YP_003197342.1 two component transcriptional regulator, winged helix family NC_002758.1121390.p0 Protein 5e-36 44
Dret_0467 YP_003197342.1 two component transcriptional regulator, winged helix family NC_010079.5776364.p0 Protein 5e-36 44
Dret_0467 YP_003197342.1 two component transcriptional regulator, winged helix family NC_002952.2859858.p0 Protein 5e-36 44
Dret_0467 YP_003197342.1 two component transcriptional regulator, winged helix family NC_007622.3794948.p0 Protein 5e-36 44
Dret_0467 YP_003197342.1 two component transcriptional regulator, winged helix family NC_012469.1.7685629. Protein 4e-36 44
Dret_0467 YP_003197342.1 two component transcriptional regulator, winged helix family CP001918.1.gene5135. Protein 3e-23 43
Dret_0467 YP_003197342.1 two component transcriptional regulator, winged helix family AE015929.1.gene1106. Protein 2e-32 42
Dret_0467 YP_003197342.1 two component transcriptional regulator, winged helix family NC_012469.1.7686381. Protein 5e-37 42
Dret_0467 YP_003197342.1 two component transcriptional regulator, winged helix family BAC0197 Protein 6e-26 42
Dret_0467 YP_003197342.1 two component transcriptional regulator, winged helix family CP001918.1.gene3444. Protein 3e-31 42
Dret_0467 YP_003197342.1 two component transcriptional regulator, winged helix family BAC0039 Protein 2e-31 42
Dret_0467 YP_003197342.1 two component transcriptional regulator, winged helix family CP000034.1.gene2186. Protein 2e-31 42
Dret_0467 YP_003197342.1 two component transcriptional regulator, winged helix family NC_002695.1.916589.p Protein 2e-31 42
Dret_0467 YP_003197342.1 two component transcriptional regulator, winged helix family BAC0347 Protein 2e-27 41
Dret_0467 YP_003197342.1 two component transcriptional regulator, winged helix family CP000034.1.gene3671. Protein 3e-33 41
Dret_0467 YP_003197342.1 two component transcriptional regulator, winged helix family CP000647.1.gene2531. Protein 6e-32 41
Dret_0467 YP_003197342.1 two component transcriptional regulator, winged helix family BAC0596 Protein 1e-30 41
Dret_0467 YP_003197342.1 two component transcriptional regulator, winged helix family CP001138.1.gene2239. Protein 1e-30 41
Dret_0467 YP_003197342.1 two component transcriptional regulator, winged helix family CP000647.1.gene4257. Protein 8e-27 41
Dret_0467 YP_003197342.1 two component transcriptional regulator, winged helix family NC_002695.1.915041.p Protein 1e-25 41
Dret_0467 YP_003197342.1 two component transcriptional regulator, winged helix family CP001138.1.gene4273. Protein 2e-26 41
Dret_0467 YP_003197342.1 two component transcriptional regulator, winged helix family BAC0533 Protein 8e-27 41
Dret_0467 YP_003197342.1 two component transcriptional regulator, winged helix family CP000034.1.gene3834. Protein 1e-25 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Dret_0467 YP_003197342.1 two component transcriptional regulator, winged helix family VFG1702 Protein 4e-35 42
Dret_0467 YP_003197342.1 two component transcriptional regulator, winged helix family VFG1563 Protein 1e-34 42
Dret_0467 YP_003197342.1 two component transcriptional regulator, winged helix family VFG1389 Protein 8e-25 41