Gene Information

Name : RB2501_02820 (RB2501_02820)
Accession : YP_003196784.1
Strain : Robiginitalea biformata HTCC2501
Genome accession: NC_013222
Putative virulence/resistance : Virulence
Product : two-component system response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 3428662 - 3429351 bp
Length : 690 bp
Strand : +
Note : -

DNA sequence :
ATGGGGAACCGCATCCTCCTGATCGAAGACGAATACGCCATTGCCTCCTTTGTTACCCAGGGATTGCAGGAATCGGGCTA
TGCGGTCGCGGTTTGCTACGACGGGGAAAAGGGGCTTGAAATGCTGCAGGATGGGGATTTCGACCTGGTCATCCTGGATA
TCGTCCTGCCTGGGATGGACGGACGGGAGGTGGCCCGTACTATCCGGGGCCAGGGTCTGGACCTTCCGATTCTGATGCTC
ACCGCCCTCGGTTCTACTGAAAACGTCGTCCGGGGTCTCGATTCGGGGGCGGATGACTACCTGGTCAAGCCATTTAAATT
CAAAGAGCTCGAGGCGCGGGTCCGGGCCCTTTCCAGGCGCCGGTCTTCCGGTCCCCGGGGCAACCGCACCCTCTCAGCGG
GCAACCTGGTTCTCGACCGGGATGCGAAAACCGTCAGACGCGGAGAAGCGGATATCCACCTGACCGCTACCGAGTACCGC
CTTCTGGAGTACCTTTTGCTCAATAAAAACCGGGTGCTGAGCCGGATTGACATCCTGGAAAGCGTCTGGGACATCACCTT
CAACCTGGGGACCAATGTGGTGGATGTATACGTAAATTACCTGCGGAACAAAATCGACAAACCTTTCGATTCAAAACTGA
TCCACACCGTGATCGGCATGGGGTACACCCTGAAAGACAACGAACCCTAA

Protein sequence :
MGNRILLIEDEYAIASFVTQGLQESGYAVAVCYDGEKGLEMLQDGDFDLVILDIVLPGMDGREVARTIRGQGLDLPILML
TALGSTENVVRGLDSGADDYLVKPFKFKELEARVRALSRRRSSGPRGNRTLSAGNLVLDRDAKTVRRGEADIHLTATEYR
LLEYLLLNKNRVLSRIDILESVWDITFNLGTNVVDVYVNYLRNKIDKPFDSKLIHTVIGMGYTLKDNEP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-33 45
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 5e-33 44

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
RB2501_02820 YP_003196784.1 two-component system response regulator HE999704.1.gene1528. Protein 5e-34 46
RB2501_02820 YP_003196784.1 two-component system response regulator NC_007622.3794948.p0 Protein 6e-31 45
RB2501_02820 YP_003196784.1 two-component system response regulator NC_003923.1003417.p0 Protein 6e-31 45
RB2501_02820 YP_003196784.1 two-component system response regulator NC_013450.8614146.p0 Protein 6e-31 45
RB2501_02820 YP_003196784.1 two-component system response regulator NC_002951.3238224.p0 Protein 6e-31 45
RB2501_02820 YP_003196784.1 two-component system response regulator NC_007793.3914065.p0 Protein 6e-31 45
RB2501_02820 YP_003196784.1 two-component system response regulator NC_002758.1121390.p0 Protein 6e-31 45
RB2501_02820 YP_003196784.1 two-component system response regulator NC_010079.5776364.p0 Protein 6e-31 45
RB2501_02820 YP_003196784.1 two-component system response regulator NC_002952.2859858.p0 Protein 6e-31 45
RB2501_02820 YP_003196784.1 two-component system response regulator BAC0308 Protein 1e-35 45
RB2501_02820 YP_003196784.1 two-component system response regulator BAC0125 Protein 4e-41 45
RB2501_02820 YP_003196784.1 two-component system response regulator BAC0638 Protein 1e-30 44
RB2501_02820 YP_003196784.1 two-component system response regulator AE000516.2.gene3505. Protein 2e-27 42
RB2501_02820 YP_003196784.1 two-component system response regulator AE015929.1.gene1106. Protein 2e-25 41
RB2501_02820 YP_003196784.1 two-component system response regulator BAC0111 Protein 3e-38 41
RB2501_02820 YP_003196784.1 two-component system response regulator BAC0197 Protein 3e-32 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
RB2501_02820 YP_003196784.1 two-component system response regulator VFG0596 Protein 5e-34 45
RB2501_02820 YP_003196784.1 two-component system response regulator VFG1390 Protein 2e-37 44
RB2501_02820 YP_003196784.1 two-component system response regulator VFG1389 Protein 3e-28 42