Gene Information

Name : Dtox_2993 (Dtox_2993)
Accession : YP_003192370.1
Strain : Desulfotomaculum acetoxidans DSM 771
Genome accession: NC_013216
Putative virulence/resistance : Resistance
Product : stress protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG2310
EC number : -
Position : 3184415 - 3184990 bp
Length : 576 bp
Strand : -
Note : PFAM: stress protein; KEGG: bsu:BSU02910 hypothetical protein

DNA sequence : 
ATGGCTGTTAATTTACAAAAAGGGCAAAAGGTTGATTTAACAAAGGGTAGAGAAGGTCTTTCCAAGGTAGTTGTAGGGCT
TGGTTGGGATACTAACAAATTTGACGGTCCTGATTTTGACCTGGATGCTTCCGCTTTTCTGTTAGGTGATAACGGTAAGT
GCGCAAGCCCTGATGATTTTGTGTTTTATAATAACCTTACCCACAAGAGCGGTTCAGTTCAACACATGGGGGACAACCTT
ACCGGTGACGGAGAAGGTGACGATGAGCAAATTACCATTGATCTTTCTAAAATTCCCGCCAATATACAAAAAATAGCCAT
TACTGTTACTATTCATATGGCTCAAGAACGTGGTCAAAACTTCGGTCTTGTATCCAACGCATTTGTTCGAGTAGTTGATG
ATGCCTACAATCAAGAATTACTCCGTTATGACTTATCGGAAGATTACAGTATTGAAACTGCATTGGTTTTCTGTGAGCTA
TATCGTAAGGGAACAGAGTGGAAGTTTGCAGCTGTAGGTCAAGGTTTTAATGATGGCTTGCAGGGATTGGTTAGACTCTA
TGGCTTGGACGCTTAA

Protein sequence : 
MAVNLQKGQKVDLTKGREGLSKVVVGLGWDTNKFDGPDFDLDASAFLLGDNGKCASPDDFVFYNNLTHKSGSVQHMGDNL
TGDGEGDDEQITIDLSKIPANIQKIAITVTIHMAQERGQNFGLVSNAFVRVVDDAYNQELLRYDLSEDYSIETALVFCEL
YRKGTEWKFAAVGQGFNDGLQGLVRLYGLDA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 1e-52 56
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 3e-46 55
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 2e-48 55
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 4e-46 55
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 4e-46 55
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 9e-49 55
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 9e-49 55
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 3e-45 52
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 7e-29 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Dtox_2993 YP_003192370.1 stress protein BAC0390 Protein 2e-50 57
Dtox_2993 YP_003192370.1 stress protein BAC0389 Protein 2e-47 54