Gene Information

Name : Dtox_2915 (Dtox_2915)
Accession : YP_003192294.1
Strain : Desulfotomaculum acetoxidans DSM 771
Genome accession: NC_013216
Putative virulence/resistance : Resistance
Product : two component transcriptional regulator, winged helix family
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 3096067 - 3096744 bp
Length : 678 bp
Strand : -
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver; KEGG: bar:GBAA3661 DNA-binding response regulator

DNA sequence :
ATGGCTTCGGTAAAGAAAATTTTAATAGCTGATGATGAGCCGCGCATGTTAAAACTGGTATCCGATTTCTTAAAAAAAGA
TGGGCATAGCGTTTTCGTAGCTGATAACGGTCGACAGGCCTTGGATATTTTCAATGAACAGCAGTTGGATCTGGTTATTT
TGGATGTTATGATGCCTGAGTATGACGGTTGGGCTGTATGCAGGGAAATCCGCAAAACTTCTCATGTTCCTATAATTATG
CTGACAGCCAGGGCTGAAGAGTCGGATGAACTGTTTGGGTTTGAATTGGGAGCGGATGAATATGTTACAAAGCCCTTTAG
CCCCAAAATATTGGTAGCCAGAGTTCAAGCCTTATTGAGAAGAATAGCGGAGCACAAAAATCAGATGATTTCCATTGAAG
GGCTGGAAATAGATGAGAGCGGTCGTTGTGTGACAGTTGACGGGGTGCCTCTGGATTTAAGTATGAAGGAGTTTGAGTTG
TTAAACTACCTTGTAAATAACCAGGGCAGAGCGTTGAACCGGGATCAGATTTTGAATGCGGTGTGGGATTATAATTATTT
TGGAGATGCCAGGACCGTTGATACCCACATAAAAAATCTAAGGCATAAACTTGGTGCTAAGGGTTTGTTTATTAAAACTA
TTCGAGGTTTGGGGTATAAGTTTGAGGTGAGATCATGA

Protein sequence :
MASVKKILIADDEPRMLKLVSDFLKKDGHSVFVADNGRQALDIFNEQQLDLVILDVMMPEYDGWAVCREIRKTSHVPIIM
LTARAEESDELFGFELGADEYVTKPFSPKILVARVQALLRRIAEHKNQMISIEGLEIDESGRCVTVDGVPLDLSMKEFEL
LNYLVNNQGRALNRDQILNAVWDYNYFGDARTVDTHIKNLRHKLGAKGLFIKTIRGLGYKFEVRS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
vanRB YP_008394254.1 DNA-binding response regulator VanRB Not tested Not named Protein 3e-36 42
vanRB NP_815956.1 DNA-binding response regulator VanRB Not tested Not named Protein 7e-35 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Dtox_2915 YP_003192294.1 two component transcriptional regulator, winged helix family NC_012469.1.7685629. Protein 5e-43 47
Dtox_2915 YP_003192294.1 two component transcriptional regulator, winged helix family NC_002952.2859905.p0 Protein 2e-42 46
Dtox_2915 YP_003192294.1 two component transcriptional regulator, winged helix family NC_002951.3237708.p0 Protein 2e-42 46
Dtox_2915 YP_003192294.1 two component transcriptional regulator, winged helix family NC_007622.3794472.p0 Protein 2e-42 46
Dtox_2915 YP_003192294.1 two component transcriptional regulator, winged helix family NC_002758.1121668.p0 Protein 2e-42 46
Dtox_2915 YP_003192294.1 two component transcriptional regulator, winged helix family NC_009641.5332272.p0 Protein 2e-42 46
Dtox_2915 YP_003192294.1 two component transcriptional regulator, winged helix family NC_013450.8614421.p0 Protein 2e-42 46
Dtox_2915 YP_003192294.1 two component transcriptional regulator, winged helix family NC_007793.3914279.p0 Protein 2e-42 46
Dtox_2915 YP_003192294.1 two component transcriptional regulator, winged helix family NC_003923.1003749.p0 Protein 2e-42 46
Dtox_2915 YP_003192294.1 two component transcriptional regulator, winged helix family NC_002745.1124361.p0 Protein 2e-42 46
Dtox_2915 YP_003192294.1 two component transcriptional regulator, winged helix family NC_009782.5559369.p0 Protein 2e-42 46
Dtox_2915 YP_003192294.1 two component transcriptional regulator, winged helix family HE999704.1.gene1202. Protein 2e-41 43
Dtox_2915 YP_003192294.1 two component transcriptional regulator, winged helix family HE999704.1.gene2815. Protein 3e-40 43
Dtox_2915 YP_003192294.1 two component transcriptional regulator, winged helix family AF310956.2.orf0.gene Protein 1e-36 42
Dtox_2915 YP_003192294.1 two component transcriptional regulator, winged helix family AE016830.1.gene2255. Protein 3e-35 41
Dtox_2915 YP_003192294.1 two component transcriptional regulator, winged helix family U35369.1.gene1.p01 Protein 3e-35 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Dtox_2915 YP_003192294.1 two component transcriptional regulator, winged helix family VFG1386 Protein 4e-32 43