Gene Information

Name : Dtox_1377 (Dtox_1377)
Accession : YP_003190876.1
Strain : Desulfotomaculum acetoxidans DSM 771
Genome accession: NC_013216
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator, winged helix family
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1408871 - 1409548 bp
Length : 678 bp
Strand : -
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver; KEGG: gme:Gmet_3383 two component transcriptional regulator

DNA sequence :
TTGTCAAGCAATATTTTGGTTATAGATGATGATCCCAGGATCACAGCTTTGTTAAAGAGAACTCTTCTTTTTAACGGATA
TACGGTTGAAGCAGCCAATGACGGAAAGGCAGGGATTACTCTCTTAGAAAATAATCATTTTGATTTAGTAATTCTGGACG
TGATGATGCCCGGTCTGGATGGCTGGCAAGTCTGCGGGCAAATCAGGGAATACTATGATTTACCCGTTTTAATGTTGACC
GCCAGGGATGAAGTGGAAGACAGAGTAAAAGGGCTTGATTTGGGAGCCGATGATTACCTGGTCAAACCTTTTGCCATGAC
TGAGTTACTGGCCAGGATCCGCGCGCTGCTGCGCAGGAGCGGTAAAACGGAAGCTCAGCCGGCAATACTCAGTTATGCCG
ATTTGTCCATGGATACCGGCACCAGAGAGGTATTCAGAAATAAAAGACAGCTTAATCCAACTGCCAGGGAATATGAACTG
TTAAAGCTTTTTATGGAAAACCCCCGACTGGTACTCAACAAGGAATTGATCATGGAAAGAATATGGGGTTATGATTACCA
GGGCGAATCAAATGTTTTGGAAGTTTATATTGTCATGCTGAGAAATAAATTGGAGGCTTGCGGTGAAAAGCGCCTTATTC
ATACAGTGAGAGGAGCAGGTTATGTATTAAAAGAATAA

Protein sequence :
MSSNILVIDDDPRITALLKRTLLFNGYTVEAANDGKAGITLLENNHFDLVILDVMMPGLDGWQVCGQIREYYDLPVLMLT
ARDEVEDRVKGLDLGADDYLVKPFAMTELLARIRALLRRSGKTEAQPAILSYADLSMDTGTREVFRNKRQLNPTAREYEL
LKLFMENPRLVLNKELIMERIWGYDYQGESNVLEVYIVMLRNKLEACGEKRLIHTVRGAGYVLKE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 5e-34 43
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 5e-33 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Dtox_1377 YP_003190876.1 two component transcriptional regulator, winged helix family BAC0125 Protein 2e-41 47
Dtox_1377 YP_003190876.1 two component transcriptional regulator, winged helix family BAC0083 Protein 5e-37 46
Dtox_1377 YP_003190876.1 two component transcriptional regulator, winged helix family BAC0638 Protein 1e-33 46
Dtox_1377 YP_003190876.1 two component transcriptional regulator, winged helix family HE999704.1.gene1528. Protein 1e-38 44
Dtox_1377 YP_003190876.1 two component transcriptional regulator, winged helix family BAC0308 Protein 5e-38 43
Dtox_1377 YP_003190876.1 two component transcriptional regulator, winged helix family BAC0197 Protein 1e-36 43
Dtox_1377 YP_003190876.1 two component transcriptional regulator, winged helix family NC_002952.2859905.p0 Protein 5e-32 42
Dtox_1377 YP_003190876.1 two component transcriptional regulator, winged helix family NC_007622.3794472.p0 Protein 4e-32 42
Dtox_1377 YP_003190876.1 two component transcriptional regulator, winged helix family AE015929.1.gene1106. Protein 3e-31 41
Dtox_1377 YP_003190876.1 two component transcriptional regulator, winged helix family CP000675.2.gene1535. Protein 2e-26 41
Dtox_1377 YP_003190876.1 two component transcriptional regulator, winged helix family NC_003923.1003749.p0 Protein 6e-32 41
Dtox_1377 YP_003190876.1 two component transcriptional regulator, winged helix family NC_002758.1121668.p0 Protein 6e-32 41
Dtox_1377 YP_003190876.1 two component transcriptional regulator, winged helix family NC_009641.5332272.p0 Protein 6e-32 41
Dtox_1377 YP_003190876.1 two component transcriptional regulator, winged helix family NC_013450.8614421.p0 Protein 6e-32 41
Dtox_1377 YP_003190876.1 two component transcriptional regulator, winged helix family NC_007793.3914279.p0 Protein 6e-32 41
Dtox_1377 YP_003190876.1 two component transcriptional regulator, winged helix family NC_002745.1124361.p0 Protein 6e-32 41
Dtox_1377 YP_003190876.1 two component transcriptional regulator, winged helix family NC_009782.5559369.p0 Protein 6e-32 41
Dtox_1377 YP_003190876.1 two component transcriptional regulator, winged helix family NC_002951.3237708.p0 Protein 6e-32 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Dtox_1377 YP_003190876.1 two component transcriptional regulator, winged helix family VFG1390 Protein 7e-47 53
Dtox_1377 YP_003190876.1 two component transcriptional regulator, winged helix family VFG1389 Protein 5e-33 44
Dtox_1377 YP_003190876.1 two component transcriptional regulator, winged helix family VFG0596 Protein 2e-34 43
Dtox_1377 YP_003190876.1 two component transcriptional regulator, winged helix family VFG1386 Protein 5e-39 43