Gene Information

Name : Aaci_2983 (Aaci_2983)
Accession : YP_003186375.1
Strain :
Genome accession: NC_013206
Putative virulence/resistance : Unknown
Product : IS66 Orf2 family protein
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG3436
EC number : -
Position : 27325 - 27654 bp
Length : 330 bp
Strand : -
Note : PFAM: IS66 Orf2 family protein; KEGG: sbn:Sbal195_0639 IS66 Orf2 family protein

DNA sequence :
GTGTATCTCGCCTGCGGTGCCACAGACATGCGCAAATCCATTGACGGACTCGCCGCGCTCGTCCAGGCGTCGTTTCAGCT
CGATCCGTTTTCGCCATGTTTGTTTGTCTTCTGCAATCGGCAACGGGACAAGCTCAAAATCCTGCACTGGTCGCACAACG
GCTTTTGGCTGTACTATCGGCGCTTAGAGCGCGGCCGATTCGACTGGCCCGAGACTGGCGATGCCAAGACCATGGTGATC
ACACGGCGAGAGCTGAACTGGCTCCTGGATGGTCTGCCGCTCGAGCAGCCGAGAGCGCATCGAGCCGTGTATGTCCGTTC
TGCGATCTAA

Protein sequence :
MYLACGATDMRKSIDGLAALVQASFQLDPFSPCLFVFCNRQRDKLKILHWSHNGFWLYYRRLERGRFDWPETGDAKTMVI
TRRELNWLLDGLPLEQPRAHRAVYVRSAI

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed AAF71493.1 unknown Not tested Hrp PAI Protein 1e-16 48
Z1160 NP_286695.1 hypothetical protein Not tested TAI Protein 6e-13 46
Z1599 NP_287103.1 hypothetical protein Not tested TAI Protein 6e-13 46
ECO103_3567 YP_003223430.1 hypothetical protein Not tested LEE Protein 2e-11 45
Z4338 NP_289563.1 hypothetical protein Not tested OI-122 Protein 2e-11 45
ECUMN_3364 YP_002414037.1 putative transposase ORF2, IS66 family Not tested Not named Protein 9e-13 45
aec52 AAW51735.1 Aec52 Not tested AGI-3 Protein 1e-12 45
unnamed ADD91739.1 hypothetical protein Not tested PAI-I AL862 Protein 1e-12 45
pB171ORF50 CAD66190.1 ORF50 protein of pB171 Not tested PAI III 536 Protein 3e-12 44
unnamed AAL08461.1 unknown Not tested SRL Protein 6e-11 43
BCAM0247 YP_002232879.1 putative transposase Not tested BcenGI11 Protein 2e-11 42
Z4316 NP_289542.1 hypothetical protein Not tested OI-122 Protein 1e-10 42
ECO103_3553 YP_003223420.1 hypothetical protein Not tested LEE Protein 1e-10 42
unnamed ACU09438.1 IS66 family element orf2 Not tested LEE Protein 7e-11 42
c3578 NP_755453.1 hypothetical protein Not tested PAI I CFT073 Protein 1e-10 42
Z4336 NP_289561.1 hypothetical protein Not tested OI-122 Protein 1e-10 42
Z5097 NP_290248.1 prophage-associated protein Not tested LEE Protein 1e-10 42
ECs4546 NP_312573.1 hypothetical protein Not tested LEE Protein 1e-10 42
Z1132 NP_286667.1 hypothetical protein Not tested TAI Protein 1e-10 42
unnamed AAC31493.1 L0014 Not tested LEE Protein 7e-11 42
c3561 NP_755436.1 hypothetical protein Not tested PAI I CFT073 Protein 9e-11 42
Z1571 NP_287075.1 hypothetical protein Not tested TAI Protein 1e-10 42
hp4 AAC61716.1 Hp4 Not tested PAI I CFT073 Protein 7e-11 42
ECUMN_3327 YP_002414007.1 putative transposase ORF2, IS66 family Not tested Not named Protein 9e-11 42
unnamed AAL99258.1 unknown Not tested LEE Protein 7e-11 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Aaci_2983 YP_003186375.1 IS66 Orf2 family protein VFG1737 Protein 2e-13 45
Aaci_2983 YP_003186375.1 IS66 Orf2 family protein VFG1665 Protein 1e-12 44
Aaci_2983 YP_003186375.1 IS66 Orf2 family protein VFG1052 Protein 2e-11 43
Aaci_2983 YP_003186375.1 IS66 Orf2 family protein VFG1709 Protein 3e-11 42
Aaci_2983 YP_003186375.1 IS66 Orf2 family protein VFG0792 Protein 3e-11 42
Aaci_2983 YP_003186375.1 IS66 Orf2 family protein VFG1698 Protein 3e-11 42