Gene Information

Name : Aaci_0044 (Aaci_0044)
Accession : YP_003183497.1
Strain : Alicyclobacillus acidocaldarius DSM 446
Genome accession: NC_013205
Putative virulence/resistance : Resistance
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 55675 - 56349 bp
Length : 675 bp
Strand : +
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver; KEGG: dds:Ddes_0567 two component transcriptional regulator, winged helix family

DNA sequence :
ATGGCGACCATCCTCGTGGCCGACGACGAGCCTCACATCCGCGAACTCGTGCGCAGCACGCTGGAGCGGGAGGGGCATCG
GGTGGTGGAGGCGGCGGACGGGCGCGAGGCGGCGGATGCGGTGGCCCGTGAGCCGGTGCAGCTCGCCGTGATCGACGTGA
TGATGCCGGAGGTGGACGGGTTCGAGCTGACGCGGTGGTTGCGCGAAGAGCGCGATGTGCCGATTCTGCTCCTGACCGCG
CTCGGGGAGACAAGCCACAAGGTGCGCGGCCTCCGGCTCGGCGCGGACGACTACCTCGTCAAGCCGTTCGCCCCCGAGGA
GCTCGTGGCGCGCGTCGAGGCGCTCCTGCGCCGCTACCGCATTCGGGCGGACGGCGCGCTCGATCTCGCCGTACTCCGTC
TCCTCTCGGACACGTATGAAGTCGAGGCGAACGGGGAGCGCATGGCGCTTCCGCCGAAGGAGTTTCAGCTTCTGTTCACG
CTGGCCGCGTCGGCGGGCAGGACGCTCTCCCGCGACAAGCTGATTGAAGAGGTGTGGGGGTACGACTACGCGGGGGACGA
GCGGACGGTGGACGTGCACATCAAGCGGTTGCGCGTCAAGTTCCCCGAGGACGTGTATCCGTTTCGCATCCGCACCGTGC
GCGGGTTGGGCTATCGCCTGGAGGTGAACGCGTGA

Protein sequence :
MATILVADDEPHIRELVRSTLEREGHRVVEAADGREAADAVAREPVQLAVIDVMMPEVDGFELTRWLREERDVPILLLTA
LGETSHKVRGLRLGADDYLVKPFAPEELVARVEALLRRYRIRADGALDLAVLRLLSDTYEVEANGERMALPPKEFQLLFT
LAASAGRTLSRDKLIEEVWGYDYAGDERTVDVHIKRLRVKFPEDVYPFRIRTVRGLGYRLEVNA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-26 42
vanRB YP_008394254.1 DNA-binding response regulator VanRB Not tested Not named Protein 1e-35 41
vanRB NP_815956.1 DNA-binding response regulator VanRB Not tested Not named Protein 3e-34 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Aaci_0044 YP_003183497.1 winged helix family two component transcriptional regulator BAC0111 Protein 5e-30 45
Aaci_0044 YP_003183497.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 2e-37 44
Aaci_0044 YP_003183497.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 4e-35 44
Aaci_0044 YP_003183497.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 4e-35 44
Aaci_0044 YP_003183497.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 4e-35 44
Aaci_0044 YP_003183497.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 4e-35 44
Aaci_0044 YP_003183497.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 4e-35 44
Aaci_0044 YP_003183497.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 3e-35 44
Aaci_0044 YP_003183497.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 4e-35 44
Aaci_0044 YP_003183497.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 4e-35 44
Aaci_0044 YP_003183497.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 4e-35 44
Aaci_0044 YP_003183497.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 4e-35 44
Aaci_0044 YP_003183497.1 winged helix family two component transcriptional regulator BAC0347 Protein 2e-27 44
Aaci_0044 YP_003183497.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 4e-34 43
Aaci_0044 YP_003183497.1 winged helix family two component transcriptional regulator AF155139.2.orf0.gene Protein 3e-36 42
Aaci_0044 YP_003183497.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 5e-26 42
Aaci_0044 YP_003183497.1 winged helix family two component transcriptional regulator AF310956.2.orf0.gene Protein 5e-36 41
Aaci_0044 YP_003183497.1 winged helix family two component transcriptional regulator U35369.1.gene1.p01 Protein 1e-34 41
Aaci_0044 YP_003183497.1 winged helix family two component transcriptional regulator AE016830.1.gene2255. Protein 1e-34 41
Aaci_0044 YP_003183497.1 winged helix family two component transcriptional regulator AE016830.1.gene1681. Protein 3e-33 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Aaci_0044 YP_003183497.1 winged helix family two component transcriptional regulator VFG1390 Protein 3e-27 45
Aaci_0044 YP_003183497.1 winged helix family two component transcriptional regulator VFG0596 Protein 7e-27 42
Aaci_0044 YP_003183497.1 winged helix family two component transcriptional regulator VFG1389 Protein 5e-22 42