Gene Information

Name : Aaci_2264 (Aaci_2264)
Accession : YP_003185662.1
Strain : Alicyclobacillus acidocaldarius DSM 446
Genome accession: NC_013205
Putative virulence/resistance : Resistance
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2324927 - 2325622 bp
Length : 696 bp
Strand : +
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver; KEGG: sfu:Sfum_2007 two component transcriptional regulator, winged helix family

DNA sequence :
ATGCGCATCTTGCTCGTCGAAGACGAGGTGCGGCTCGCGTCCGCACTCAAACAACTTCTCAAGGAACACCAGTATGCGGT
CGACGTCGCCCACGACGGCGAAACCGGCTGCGATCTCGCCCTCACGGACAGCTACGACCTCGCCATCCTCGACATCATGC
TGCCGAAGATGAGCGGCCTCGACATCCTGCGCGCCATGCGCAAGGCGGGCCTGCAAACGCCCGTGCTGCTCCTCACGGCC
AAGGACACCGTCGAAGACCGCGTGACGGGCCTCGACGCCGGGGCCGACGACTACCTGGTCAAGCCGTTTGACAACAAGGA
GCTTTTGGCGCGCGTGCGGGCCCTCTCTCGGCGCACCGGCCAGATTGCGGGCGGCGACGCCATCGAGGCGGGCCCGTTTC
GACTCGATCTTAACACTCGAACGGTGACGCGCAACGGGGAACCCTTGGCGCTGACGGCCAAAGAGTTCCAGCTGCTTGAG
CTGTTCATGCGCAACCCCAACAAAGTGTTGTCCAAAGAGGTCATTCTCGATCGCGTCTGGGGACCGGATGCGGACGTGAT
CGGCAACGCGGTGGAAAACTACGTGCACTTCTTGCGGAAAAAAATCGACGAGCCCGACCTGCCGTCGTATATCACCACCG
TGCGAGGCGTGGGATACATGTTCCATCCGGACCCGGCGGCGGGCCGCAAGGCGTGA

Protein sequence :
MRILLVEDEVRLASALKQLLKEHQYAVDVAHDGETGCDLALTDSYDLAILDIMLPKMSGLDILRAMRKAGLQTPVLLLTA
KDTVEDRVTGLDAGADDYLVKPFDNKELLARVRALSRRTGQIAGGDAIEAGPFRLDLNTRTVTRNGEPLALTAKEFQLLE
LFMRNPNKVLSKEVILDRVWGPDADVIGNAVENYVHFLRKKIDEPDLPSYITTVRGVGYMFHPDPAAGRKA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-38 44
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 2e-37 44
vanRB YP_008394254.1 DNA-binding response regulator VanRB Not tested Not named Protein 3e-33 41
vanRB NP_815956.1 DNA-binding response regulator VanRB Not tested Not named Protein 1e-32 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Aaci_2264 YP_003185662.1 winged helix family two component transcriptional regulator BAC0111 Protein 2e-45 48
Aaci_2264 YP_003185662.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 1e-38 47
Aaci_2264 YP_003185662.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 1e-38 47
Aaci_2264 YP_003185662.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 1e-38 47
Aaci_2264 YP_003185662.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 1e-38 47
Aaci_2264 YP_003185662.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 1e-38 47
Aaci_2264 YP_003185662.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 1e-38 47
Aaci_2264 YP_003185662.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 1e-38 47
Aaci_2264 YP_003185662.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 1e-38 47
Aaci_2264 YP_003185662.1 winged helix family two component transcriptional regulator BAC0347 Protein 2e-42 47
Aaci_2264 YP_003185662.1 winged helix family two component transcriptional regulator BAC0197 Protein 2e-38 46
Aaci_2264 YP_003185662.1 winged helix family two component transcriptional regulator BAC0083 Protein 6e-43 45
Aaci_2264 YP_003185662.1 winged helix family two component transcriptional regulator HE999704.1.gene1528. Protein 6e-39 45
Aaci_2264 YP_003185662.1 winged helix family two component transcriptional regulator BAC0638 Protein 7e-35 45
Aaci_2264 YP_003185662.1 winged helix family two component transcriptional regulator BAC0308 Protein 1e-36 44
Aaci_2264 YP_003185662.1 winged helix family two component transcriptional regulator AE015929.1.gene1106. Protein 5e-35 43
Aaci_2264 YP_003185662.1 winged helix family two component transcriptional regulator BAC0125 Protein 3e-37 43
Aaci_2264 YP_003185662.1 winged helix family two component transcriptional regulator NC_002516.2.879194.p Protein 1e-30 43
Aaci_2264 YP_003185662.1 winged helix family two component transcriptional regulator Y16952.3.orf35.gene. Protein 1e-27 42
Aaci_2264 YP_003185662.1 winged helix family two component transcriptional regulator BAC0288 Protein 3e-33 42
Aaci_2264 YP_003185662.1 winged helix family two component transcriptional regulator AF310956.2.orf0.gene Protein 1e-33 41
Aaci_2264 YP_003185662.1 winged helix family two component transcriptional regulator U35369.1.gene1.p01 Protein 5e-33 41
Aaci_2264 YP_003185662.1 winged helix family two component transcriptional regulator AE016830.1.gene2255. Protein 5e-33 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Aaci_2264 YP_003185662.1 winged helix family two component transcriptional regulator VFG1390 Protein 3e-43 45
Aaci_2264 YP_003185662.1 winged helix family two component transcriptional regulator VFG0596 Protein 9e-39 44