|
Name : Aaci_1114 (Aaci_1114) Accession : YP_003184538.1 Strain : Alicyclobacillus acidocaldarius DSM 446 Genome accession: NC_013205 Putative virulence/resistance : Resistance Product : heavy metal transport/detoxification protein Function : - COG functional category : P : Inorganic ion transport and metabolism COG ID : COG2608 EC number : - Position : 1169852 - 1170058 bp Length : 207 bp Strand : + Note : PFAM: Heavy metal transport/detoxification protein; KEGG: hiq:CGSHiGG_04270 mercuric ion scavenger protein DNA sequence : ATGACAACAGCAACCATCATCGTCAAAGGCATGACGTGCAGCGGTTGCGTAAACTCCGTCACCAAGGCGCTCAAAAACGT GGAGGGTGTCCAGGAGGCGAGCGTGGATCTAGAAGGACAGAAAGCTACGGTCACCTTTGACGAGACGAAGACCAACTTGG CCACGCTGAAAGAGGCCATCGAGGACGCCGGTTACGATACAGAGTGA Protein sequence : MTTATIIVKGMTCSGCVNSVTKALKNVEGVQEASVDLEGQKATVTFDETKTNLATLKEAIEDAGYDTE |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| merP | CAJ77062.1 | Periplasmic mercuric ion binding protein | Not tested | AbaR1 | Protein | 3e-10 | 48 |
| merP | YP_006098389.1 | mercuric ion transport protein | Not tested | Tn2411 | Protein | 9e-10 | 48 |
| merP | ACN81007.1 | MerP periplasmic mercuric ion binding protein | Not tested | AbaR5 | Protein | 5e-10 | 48 |
| merP | ABQ57373.1 | MerP | Not tested | SGI1 | Protein | 6e-10 | 48 |
| merP | AET25399.1 | MerP | Not tested | PAGI-2(C) | Protein | 6e-10 | 48 |
| merP | AFG30122.1 | MerP | Not tested | PAGI-2 | Protein | 6e-10 | 48 |
| merP | AGK07023.1 | MerP | Not tested | SGI1 | Protein | 6e-10 | 48 |
| merP | AGK07081.1 | MerP | Not tested | SGI1 | Protein | 6e-10 | 48 |
| Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
| Aaci_1114 | YP_003184538.1 | heavy metal transport/detoxification protein | BAC0231 | Protein | 2e-10 | 50 |
| Aaci_1114 | YP_003184538.1 | heavy metal transport/detoxification protein | BAC0678 | Protein | 3e-10 | 48 |
| Aaci_1114 | YP_003184538.1 | heavy metal transport/detoxification protein | BAC0674 | Protein | 1e-09 | 47 |
| Aaci_1114 | YP_003184538.1 | heavy metal transport/detoxification protein | BAC0679 | Protein | 7e-10 | 47 |
| Aaci_1114 | YP_003184538.1 | heavy metal transport/detoxification protein | BAC0675 | Protein | 3e-10 | 46 |
| Aaci_1114 | YP_003184538.1 | heavy metal transport/detoxification protein | BAC0634 | Protein | 2e-06 | 43 |
