Gene Information

Name : Elen_2866 (Elen_2866)
Accession : YP_003183201.1
Strain : Eggerthella lenta DSM 2243
Genome accession: NC_013204
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 3328649 - 3329344 bp
Length : 696 bp
Strand : +
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver; KEGG: dds:Ddes_0567 two component transcriptional regulator, winged helix family

DNA sequence :
ATGAACGACACCCCGCATCGCATTCTCGTTGTTGACGACGAGCCCTCTATTACCGAATTCGTCAGTTACGCCCTCAAGAA
GGAGGGGTTCTTCACCGACGTGGTGGACAACGGCGAAGACGCGCTGGCGTTGGCCACGAAGAACTCGTACGATCTGTTCG
TGCTCGACATCATGCTGCCCGGCATGGACGGCTACGAGCTGTGCCGCCGCCTGCGCTCGAAGACGACCGTCCCCGTGTTG
TTCCTGTCGGCTCGCGACACCGAGCTGGACAAGGTGGTGGGCCTGGAAATCGGCGGCGATGACTACTTGGCGAAGCCCTT
CGGCGTGCGAGAGCTCATCGCACGCGTCCGCGCCCTGCTGCGCCGCGGATCGGGCGGCGACTTCCCCGGCGCTAACCACG
CCGTCACCGCCAGCGGTATCACGCTTGACGAGGACGCCCACACGGCGTCGGGCGCGAACGGCGAGATCGACCTCACACCG
CGCGAGTTCGAGTTGCTTGCCAGCCTCATGAAGAACGCCGGCAAGGTGGTTTCGCGCGAAGATCTGCTGCGCGACGCCTG
GGGTTGGGAATACTTGACGGAAACCAAGACCGTCGACACCCACATCAAGCGTCTGCGTGATAAGATTGAGTCCGCCGGGT
ACGATCCCGGCTTGGTGGAAACGGTTCGCGGCTACGGATACAGGTTCAAGCAATAA

Protein sequence :
MNDTPHRILVVDDEPSITEFVSYALKKEGFFTDVVDNGEDALALATKNSYDLFVLDIMLPGMDGYELCRRLRSKTTVPVL
FLSARDTELDKVVGLEIGGDDYLAKPFGVRELIARVRALLRRGSGGDFPGANHAVTASGITLDEDAHTASGANGEIDLTP
REFELLASLMKNAGKVVSREDLLRDAWGWEYLTETKTVDTHIKRLRDKIESAGYDPGLVETVRGYGYRFKQ

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 8e-36 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Elen_2866 YP_003183201.1 winged helix family two component transcriptional regulator NC_012469.1.7686381. Protein 3e-48 45
Elen_2866 YP_003183201.1 winged helix family two component transcriptional regulator AE016830.1.gene1681. Protein 3e-47 43
Elen_2866 YP_003183201.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 4e-43 43
Elen_2866 YP_003183201.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 2e-44 42
Elen_2866 YP_003183201.1 winged helix family two component transcriptional regulator BAC0197 Protein 3e-40 42
Elen_2866 YP_003183201.1 winged helix family two component transcriptional regulator BAC0347 Protein 3e-34 41
Elen_2866 YP_003183201.1 winged helix family two component transcriptional regulator BAC0083 Protein 7e-40 41
Elen_2866 YP_003183201.1 winged helix family two component transcriptional regulator BAC0308 Protein 5e-37 41
Elen_2866 YP_003183201.1 winged helix family two component transcriptional regulator BAC0125 Protein 9e-40 41
Elen_2866 YP_003183201.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 3e-44 41
Elen_2866 YP_003183201.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 4e-39 41
Elen_2866 YP_003183201.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 5e-44 41
Elen_2866 YP_003183201.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 5e-44 41
Elen_2866 YP_003183201.1 winged helix family two component transcriptional regulator BAC0638 Protein 2e-33 41
Elen_2866 YP_003183201.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 5e-44 41
Elen_2866 YP_003183201.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 5e-44 41
Elen_2866 YP_003183201.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 5e-44 41
Elen_2866 YP_003183201.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 4e-44 41
Elen_2866 YP_003183201.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 5e-44 41
Elen_2866 YP_003183201.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 3e-44 41
Elen_2866 YP_003183201.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 5e-44 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Elen_2866 YP_003183201.1 winged helix family two component transcriptional regulator VFG1389 Protein 2e-30 42
Elen_2866 YP_003183201.1 winged helix family two component transcriptional regulator VFG0596 Protein 3e-36 41
Elen_2866 YP_003183201.1 winged helix family two component transcriptional regulator VFG1386 Protein 4e-36 41