Gene Information

Name : Elen_0258 (Elen_0258)
Accession : YP_003180639.1
Strain : Eggerthella lenta DSM 2243
Genome accession: NC_013204
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 349391 - 350101 bp
Length : 711 bp
Strand : +
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver; KEGG: gsu:GSU2145 DNA-binding response regulator

DNA sequence :
ATGAGCAACGAAACACGACGCATCCTTTTGGTTGAAGACGAAAAGGCCATCCGCGACGCCGTGACGGCCTATCTTGAACG
CGAGAATTACTGGGTGACGGCGGTCGGCGACGGCCAGGAGGCGCTCGAGGAGTTCTCGAAGCACCACTTCGATCTTGTCA
TCCTCGACCTCATGCTGCCCCGCGTGCCGGGCGAGCGCGTCTGCCGCGCCATCCGCGACAACTCCGACGTGCCCATTATC
ATGCTCACCGCTAAGGGCGAGGTGGAAGACCGCATCATCGGTCTGGAGCTGGGCGCCGACGACTACCTGGTGAAGCCGTT
CAGCCCCCGCGAGCTGGTTGCTCGCGCCCGCGCGCTTCTGCGCCGCGTGCACGCCGATTCCGAGCCGCAGCGCGAAGTGC
TGGAGTTCGGCGAGCTCACCATCGACGTGTCGGGGCACAAAGTGCTGGTCAACAACGAGGAGATCGATCTCACCGCCAGC
GAGTTCAAGCTGCTCACCACGCTGTCCCGCTACCCGGGTCGCGTGTACTCGCGCATGGAGCTGGTGGAGAAGGTGCTGGG
CTACGACTTCGAGGGCTACGAGCGCACCATCGACTCGCATGTGAAGAACCTGCGCGCGAAGATCGGCGACAACCCGCGCA
GCCCGAAGTGGCTGCACACCGTTCACGGCGTGGGCTACCGCTTCGAGGATCCCACGAAAGTTGCGCAGTAA

Protein sequence :
MSNETRRILLVEDEKAIRDAVTAYLERENYWVTAVGDGQEALEEFSKHHFDLVILDLMLPRVPGERVCRAIRDNSDVPII
MLTAKGEVEDRIIGLELGADDYLVKPFSPRELVARARALLRRVHADSEPQREVLEFGELTIDVSGHKVLVNNEEIDLTAS
EFKLLTTLSRYPGRVYSRMELVEKVLGYDFEGYERTIDSHVKNLRAKIGDNPRSPKWLHTVHGVGYRFEDPTKVAQ

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 1e-33 42
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 3e-33 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Elen_0258 YP_003180639.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 2e-39 45
Elen_0258 YP_003180639.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 3e-35 45
Elen_0258 YP_003180639.1 winged helix family two component transcriptional regulator NC_010410.6002989.p0 Protein 3e-38 43
Elen_0258 YP_003180639.1 winged helix family two component transcriptional regulator NC_010400.5986590.p0 Protein 3e-38 43
Elen_0258 YP_003180639.1 winged helix family two component transcriptional regulator NC_011595.7057856.p0 Protein 3e-38 43
Elen_0258 YP_003180639.1 winged helix family two component transcriptional regulator CP000675.2.gene1535. Protein 1e-37 43
Elen_0258 YP_003180639.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 2e-34 43
Elen_0258 YP_003180639.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 2e-34 43
Elen_0258 YP_003180639.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 2e-34 43
Elen_0258 YP_003180639.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 2e-34 43
Elen_0258 YP_003180639.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 2e-34 43
Elen_0258 YP_003180639.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 2e-34 43
Elen_0258 YP_003180639.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 2e-34 43
Elen_0258 YP_003180639.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 2e-34 43
Elen_0258 YP_003180639.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 2e-34 43
Elen_0258 YP_003180639.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 1e-34 43
Elen_0258 YP_003180639.1 winged helix family two component transcriptional regulator CP000034.1.gene2186. Protein 6e-32 43
Elen_0258 YP_003180639.1 winged helix family two component transcriptional regulator NC_002695.1.916589.p Protein 5e-32 43
Elen_0258 YP_003180639.1 winged helix family two component transcriptional regulator CP001138.1.gene2239. Protein 3e-31 43
Elen_0258 YP_003180639.1 winged helix family two component transcriptional regulator BAC0039 Protein 6e-32 43
Elen_0258 YP_003180639.1 winged helix family two component transcriptional regulator BAC0596 Protein 3e-31 43
Elen_0258 YP_003180639.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 8e-30 42
Elen_0258 YP_003180639.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 8e-30 42
Elen_0258 YP_003180639.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 8e-30 42
Elen_0258 YP_003180639.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 8e-30 42
Elen_0258 YP_003180639.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 8e-30 42
Elen_0258 YP_003180639.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 8e-30 42
Elen_0258 YP_003180639.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 8e-30 42
Elen_0258 YP_003180639.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 8e-30 42
Elen_0258 YP_003180639.1 winged helix family two component transcriptional regulator AE016830.1.gene1681. Protein 2e-37 42
Elen_0258 YP_003180639.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 1e-32 42
Elen_0258 YP_003180639.1 winged helix family two component transcriptional regulator AF130997.1.orf0.gene Protein 8e-27 42
Elen_0258 YP_003180639.1 winged helix family two component transcriptional regulator EU250284.1.orf4.gene Protein 1e-27 42
Elen_0258 YP_003180639.1 winged helix family two component transcriptional regulator HE999704.1.gene1528. Protein 2e-28 42
Elen_0258 YP_003180639.1 winged helix family two component transcriptional regulator CP004022.1.gene1676. Protein 2e-31 41
Elen_0258 YP_003180639.1 winged helix family two component transcriptional regulator CP000647.1.gene2531. Protein 7e-31 41
Elen_0258 YP_003180639.1 winged helix family two component transcriptional regulator NC_005054.2598277.p0 Protein 6e-29 41
Elen_0258 YP_003180639.1 winged helix family two component transcriptional regulator NC_014475.1.orf0.gen Protein 6e-29 41
Elen_0258 YP_003180639.1 winged helix family two component transcriptional regulator AF155139.2.orf0.gene Protein 3e-33 41
Elen_0258 YP_003180639.1 winged helix family two component transcriptional regulator NC_008702.1.4607594. Protein 4e-35 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Elen_0258 YP_003180639.1 winged helix family two component transcriptional regulator VFG1702 Protein 6e-34 42
Elen_0258 YP_003180639.1 winged helix family two component transcriptional regulator VFG1563 Protein 1e-33 42
Elen_0258 YP_003180639.1 winged helix family two component transcriptional regulator VFG1390 Protein 3e-31 41
Elen_0258 YP_003180639.1 winged helix family two component transcriptional regulator VFG1389 Protein 8e-26 41